SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002364 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002364
Domain Number 1 Region: 81-202
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.02e-45
Family Regulator of G-protein signaling, RGS 0.000000614
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002364   Gene: ENSTTRG00000002520   Transcript: ENSTTRT00000002521
Sequence length 235
Comment pep:known_by_projection scaffold:turTru1:scaffold_115624:85335:111178:-1 gene:ENSTTRG00000002520 transcript:ENSTTRT00000002521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METSLFFFSQLNMCEPKEKTFFKLIYGSGKEETSKEAKIRAKEKRNRLSLLVQKPEFHED
TLSSRSGQLAKETRISPEEAVIWGESFDKLLSHKDGLETFTRFLKTEFSEENIEFWIACE
DFKKSKDPQQIIHKAKAIYEKFIQNDAPQEVNLDFHTKEIITRSITQPTLHSFDAAQSRV
YQLMEQDSYTRFLKSDIYLDLIEGRPQRPTNLRRRSRSFTYNEFQDVKSDVAIWL
Download sequence
Identical sequences ENSTTRP00000002364 ENSTTRP00000002364 XP_004275894.1.21590 XP_004315894.1.83887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]