SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002416 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002416
Domain Number 1 Region: 514-591
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.51e-23
Family Complement control module/SCR domain 0.0062
Further Details:      
 
Domain Number 2 Region: 206-268
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000419
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 3 Region: 328-385
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000055
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 4 Region: 456-511
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000167
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 5 Region: 272-323
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000431
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 6 Region: 89-148
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000328
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 7 Region: 152-213
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000511
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 8 Region: 37-95
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000157
Family Complement control module/SCR domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002416   Gene: ENSTTRG00000002576   Transcript: ENSTTRT00000002576
Sequence length 593
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1686:7752:45802:-1 gene:ENSTTRG00000002576 transcript:ENSTTRT00000002576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSKGLALIIILIISGELSAEEKPCGLPSVENGRIAQYYYTFESYYFPMSINQNLSFSCL
AGYTTETGKQEAQTTCTAAGWSPEPRCFTKCPKPDLRNGYIFDTKLFYKIQENMRYRCAS
GYKTTTGQDEGVVQCLPVGWSSQPTCRKEHETCLAPELHHGNYSTTQKMFKVKDKIRYEC
ASGYHTASGKRTEEVECHPYGWALTPRCAKLICSSLRSIENGYFHPVKQTYEEGDVVQFF
CHKNYYLSGSDLIQCYNFGWYPESPVCEGRRNRCPPPPVPLTSRIQRYSTTYRHGETVRI
ECGLNFERQGSEEIRCENGKWTESNTENCNSPPDIINGAVIGGLLASYPTGSSVEYRCNE
YYLLRGAKISHCEQGKWSSPPVCLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSKRTCASPPFIKNGVIKSSTVRTYENGS
SVEYRCFEHHFLQGSKESYCLEGVWTTPPLCLEPCTLSFDTMESNNLLLKWSFDNRPYIL
HGEYIEFLCKRDTYIEFPIIGSELRVQCDRGQLKYPRCIQRERMLSYQERLRT
Download sequence
Identical sequences ENSTTRP00000002416 ENSTTRP00000002416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]