SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002447 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002447
Domain Number 1 Region: 391-420,453-557,678-792
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.26e-52
Family Phosphate binding protein-like 0.000000174
Further Details:      
 
Domain Number 2 Region: 67-388
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.08e-22
Family L-arabinose binding protein-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002447   Gene: ENSTTRG00000002609   Transcript: ENSTTRT00000002609
Sequence length 1222
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2753:108382:122529:-1 gene:ENSTTRG00000002609 transcript:ENSTTRT00000002609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGALGPVLLLTSLLGAWAGLGPGQGEQAMTVAVVFGSSGPPEAQARIRLTPQSFLDLPL
EIQPLTVGVNNTNPSSLLTQICGLLGTARVHGIVFEDNVDTEAVAQILDFISFQTHVPIL
SISGGSAVVLTPKEPGSAFLQLGVSLEQQLQVLFKVLEEYDWSAFAVITSLHPGHTLFLK
SVRAVADANYVGWRLLDVLTLELGPGGTRAHTQRLLRQIDAPVLVAYCSREEAEVLFAEA
AQAGLVGPGHVWLVPNLALGSTDAPPASFPVGLISVVTESWRLSLRQKVRDGVAILALGA
HGYRRQHGTLPTPAGECRGHPGPVSPARKAFYRHLLNVTWEGRDFSFSPGGYLVQPTMVV
IALNRHRLWEMVGRWDHGVLHMKYPVWPRYSASLQPVVDSRHLTVATLEERPFVIVESPD
PGTGGCVPNTVPCRRHGNHTFSSGDTAPYTKLCCKGFCIDILKKLAKVVKFSYDLYLVTN
GKHGKRVRGVWNGMIGEVYYKRADMAIGSLTINEERSEIVDFSVPFVETGISVMVARSNG
TVSPSAFLEPYSPAVWVMMFVMCLTVVAITVFMFEYFSPVSYNQNLTSGKKSGGPSFTIG
KSVWLLWALVFNNSVPIENPRGTTSKIMVLVWAFFAVIFLASYTANLDAFMIEQYIDTVS
GXXXXXFQRHQDQSPPLRLGTVPNGSRERNISSISRDMHTHMVFNQRSVEDALSSLKMGK
LDAFIYDAAVLNYMAGKDEGCKLVTIGSGKVFATTGYGIAMQKDSHWKRAIDLALLQFLG
DGETQKLETVWLSGICQNEKNEVMSSKLDIDNMAGVFYMLLVAMVLALLVFAWEHLVYRM
LRHSLPNASRLDFLLAFNRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXRAPQPPVRPPTPGPSIPDVSQVSGRPDWEARCPSRTGRGGRHLSASERRQ
SPERCHYSSFPRAERSGCTFVPLLPETPEPEDLPLLRPEQLARREALMRAAWARGSRPRH
ASLPSSVTEFARPSSEPSWCPPACGRWTQAQMRLQSYREAYQEQVWAGAPSWPHGQHACL
HAHAHLPLCWGAVCPHLPPCVSHGPWHPEAWGPPGHRGRTLGLSTEYRDTGGLEEVSRVA
CGMHGFPRPCTWRRISSLESEV
Download sequence
Identical sequences ENSTTRP00000002447 ENSTTRP00000002447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]