SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002448 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002448
Domain Number 1 Region: 139-368
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.42e-50
Family C-terminal domain of adrenodoxin reductase-like 0.00000000447
Further Details:      
 
Domain Number 2 Region: 346-496
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.000000447
Family N-terminal domain of adrenodoxin reductase-like 0.000000452
Further Details:      
 
Domain Number 3 Region: 63-134
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000777
Family C-terminal domain of adrenodoxin reductase-like 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002448   Gene: ENSTTRG00000002610   Transcript: ENSTTRT00000002610
Sequence length 497
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2753:129118:139410:-1 gene:ENSTTRG00000002610 transcript:ENSTTRT00000002610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRCWRWWPWAAWPRTRPPPSESTQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXH
SRAHVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFTRTAHSDRCAFHGNVVVGRDVTVQ
ELRDAYHAVVLSYGAEDHRGLEIPGEELLGVLSARAFVGWYNGLPENRKLAPDLSCDTAV
VLGQGNVALDVARILLTPPEYLEVLLLCQKTDITEAALGALRQSQVKTVWIVGRRGPLQV
AFTIKELREMIQLPGTRPILDPADFLGLQDRIKEVPRPRKRLVELLLRAATEKPGVAEAA
RRASASRAWGLRFFRSPQQVLPSPDGRRAAGIRLAVTRLEGVGEATRAVPTGAVEDLPCG
LVLITIGYKSCPIDPNVPFDPKLGVIPNMEGRVVDVPGLYCSGWVKRGPTGVITTTMTDS
FVTGQILLQDLKAGLLPSGPRPGYAAIKALLGRRGVWPVSFSDWEKLDAEEVSRGQGAGK
PREKLLDPQEMLRLLGR
Download sequence
Identical sequences ENSTTRP00000002448 ENSTTRP00000002448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]