SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002550 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTTRP00000002550
Domain Number - Region: 11-105
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0633
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002550   Gene: ENSTTRG00000002721   Transcript: ENSTTRT00000002721
Sequence length 253
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_183:120778:137644:1 gene:ENSTTRG00000002721 transcript:ENSTTRT00000002721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCTIEKALADAKALVERLRDHDDAAESLIEQTTALNKRVEAMKQYQEEIQELNEVARHR
PRSTLVMGIQQENRQIRELQQENKELRTSLEEHQSALELIMSKYREQMFRLLMASKKDDP
GIIMKLKEQHTKIDMVHRNNSEGFFLDASRHILEAPQHGLQRRHLEANQNELQAHVDQIT
EMAAVMRKAIEIDEQQGCREQERIFQLEQENKGLREILQITRESFLNLRKDDVSESTSLS
ALVTNSDLSLRKS
Download sequence
Identical sequences ENSTTRP00000002550 ENSTTRP00000002550 XP_004270949.1.21590 XP_007446348.1.90284 XP_019791812.1.83887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]