SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002595 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002595
Domain Number 1 Region: 92-217
Classification Level Classification E-value
Superfamily PX domain 1.44e-30
Family PX domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002595   Gene: ENSTTRG00000002768   Transcript: ENSTTRT00000002767
Sequence length 344
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1332:114159:146775:-1 gene:ENSTTRG00000002768 transcript:ENSTTRT00000002767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPYVPVPMPIGNSASSFATNRNQRSSSFGSISTSSNSSKGQLEDSNMGNFKQTSVPDQ
MESTSSVCSSPLIRTKFTGADSSIEYSARPRESEEQNPETVNLEDRPSTPIILGYEVMEE
RAKFTVYKILVKKSPEESWVVFRRYTDFSRLNDKLKEMFPGFRLALPPKRWFKDNYNADF
LEDRQLGLQAFLQNLVAHKDIANCLAVREFLCLDDPPGPFDSLEESRAFCETLEETNYRF
QKELLEKQKELESLKKLLCEKQLLIDTLENRIRNLCLEPEESLIVSGTEGGQILKVESSA
LEVDQDVLDEESRADNKQCSSFSEPENSTSDIEVAEVAYNAEDD
Download sequence
Identical sequences XP_004319649.1.83887 XP_019781857.1.83887 ENSTTRP00000002595 ENSTTRP00000002595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]