SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002624 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002624
Domain Number 1 Region: 1968-2075
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.000000000000249
Family DBL homology domain (DH-domain) 0.002
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000002624
Domain Number - Region: 153-222
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00249
Family Ankyrin repeat 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002624   Gene: ENSTTRG00000002800   Transcript: ENSTTRT00000002800
Sequence length 2803
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3614:294110:543362:1 gene:ENSTTRG00000002800 transcript:ENSTTRT00000002800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLNPQQAPLYGDCVVTVLLSEEDKVEDDVVFYLVFSGSTLHHCTSTRKVSSDTLETIAP
GHDCCETVKVLLCASKEGLPVFVVAEEDFTFIQDEAYDAAQFLATSAGNQQALNFTRFLD
RSGPPSTDVNSLDEKVSLAFRHLKLPAEWNVLGTDAASHDGGPRETLMHFAARLGLLRLT
WFLLQKPGGRGALSIHNQEGATPVSLALDRGYHKLHRLLTEEDTGEPDSWSSLSYEIPYG
DCSVRHHRELDVYTLTSESEPHQEPPLPGDSCTGHIFKLMNIQQQLMKTNLTQMDSLMPS
VVTAQEPSSLPSDQDTDGQFLPCASEPTASQQLASPEGAESSQCCHGSTVGQIESSYDLS
SVVKEENTDSSCRKKNTGVESKGDEVEPAPIVDSGTTSDPDSCRQSTPDCKGKDTEGLPS
CGVRNEETGTKSSAMTTDQESPGSGGRVLQGGVALEPGTAQSFSGGELVVPSPAGASVPD
TARETERSLVNPEATIQRNVLAAGENMKERFEDSNISTAGASDLKVTDKPMDKASVPNGV
SASGFLVADKPAESLLVVSDEETAIDESTAETETSRSCEESADAPGAQNSQLILAAAKDG
ISEGLELDTPLARMCVALSPSDLTFPRPQKDVMPNQKSETDSSHVQSQNSKSPICSTTGD
DKLCAASACRQNTGTSSGVLAVEHCDDIVTQPEGTTTGLLNTQPLPTASCLEGPQANTVT
PDPDGDTQEHVDFCPLQVLDKESQGKDSKLETPLANMLEVVPHPHALVPKAEKERVSDQA
VISCRTFSLTGSPGSESVTKDDALSLVPSSQNEKGTATLEPHTDCRDGPDGDSNDLEKQP
AEDSVAGLCTPSSALDLQPSMGNTSPIGPGAECERPCLSADPEVLNIVEGVTDSSLLHVG
QAALASDSALTEEGKDQVVPESTAAQGPEDKDKAVTCSSIKDNTLRSGTLQEEPRTPPPG
QEAPGFHEEPGSAVCDEDRAPRNGNSLGTPLACLHAETKHNKEVAPPVAQLIEGGAAQSL
VPPGASLAADSSQEASGTEQNSSPPLPNLLPDGFEVLNCEQSSALDVEVKNTQSQGKTTA
CEVSGNAALDGAVVGALQGTTGTGRKDTPHNAPDIQIPQVSSSQEKNMILGLPGALPDKG
VTDPQGAAPPEVVSLGWEKGKVGGADGSRSTGDSKETQVDEEAHHVPLQPAAKEHPTETE
LSSRGDKAPGRGRDAAPTPCTVAAKAVLLPETADLIEEAASRIVDAVIERVKASGELMTE
GEISHMSLPCPSEAGPGPEQLESASAGKASAFQPAETPPMGSSRGEASGNLAGCFAGREE
PEKIIPPLQGPTPATEMPDTKAEDEMDFLSNTKESSVSEEVAVGNVASTPEVKQGPKTQA
INRESWCTIEPCPDAASLLAPTQSAECDNFLDVGLGRECASKQGVLKRESGSDSDLFHSP
SEEVDSIIFSKPEEEQLACDITGSSSSTDDTASLDRHSSHGSDVSLPQISNLNRSRDQQC
LDGFYNHGVGAEGRESESEPAGSGEMEEEEMDSITEVPANCSVLRSSMRSLSPFRRHSWG
PGKNAASDAEMNHRSMSWCPSGVQYSAALSADFNYRSFSLEGLTGGAGIGNKSSSSLEVN
SSNTKELRHPFSGEERGDSLVSLSEEDLESGQREHRMFDQQXXXXXXXXXXHNYCTSAIS
SPLTKSISLMTISHPGLDNSRPFHSTNANLTESITEENFNFLPQSPSKKDFEGKSGTKVS
RTFSYIKNKMSSSKKSRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXCGAFVHKGCRECLASCAKVKMKQPKGSLQAHDTSSLPTVIMRNK
SSQPKERPRSAVLLADETTAVPMFANRRSQQSVSLSKSVSIQNIAGVGNDENISNTWKFL
SHSTDSLNKISKVNESTESLTDEGVGTDLNEGQLMGDFEIESKQLEAESWSQIVDSKFLK
QQKKDVVKRQEVIYELMQTSHHSHTQIMSDVYSRGMTALLFEQQMVEKLFPCLDELISIH
SQFLQRILERKKDSLVDKSEKNFLIKRIGDVLVHQXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXVQAVLLTDILVFLQEKDQKYVFASLXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIFRDMTECSTPLPEDGSPTQSSRILFRS
NTEEALKGGPLMKSAINEVEILQGLVSGSLGGTLGQAVSSPVEQEGMVGPVSLPRRAETF
GGFDSHQMNASKGGEKEEGDDGQDLRRTESDSGLKKGGNANLAFMLKRNSEPVIQSVVRL
HELLSTLQGVVLQQDSYIEDQKLLLTERALTRTASRPSSLIEQEKQRSLEKQRQDLANLQ
RQQAQHLEEKRRREREWEARERALQEREARLAQREDELRRGRQDLEHELDELQQRKVAYQ
SDLERLRAAQRQLEREQEQLKREADRLSQRPADCDIGQVSHQHTKLLRIPSFLPNPEETL
LPPAPSIAKSGSLDSELSVSPKRNSISRTHKEKGPFHILGSTSQTNRVPEGQSQTPVSTS
TRLFGLAKPKEKKEKKKKNKGSRSQSGDGPASEVPAEGEEIFC
Download sequence
Identical sequences ENSTTRP00000002624 ENSTTRP00000002624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]