SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002689 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002689
Domain Number 1 Region: 95-245
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.86e-30
Family Voltage-gated potassium channels 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002689   Gene: ENSTTRG00000002868   Transcript: ENSTTRT00000002868
Sequence length 373
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2587:42777:134999:-1 gene:ENSTTRG00000002868 transcript:ENSTTRT00000002868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEVRIKGKYNISSEDYR
QLEMVILQSEPHRASVQKFAXXXXXXXXXXXXXXYGHAAPGTDAGKAFCMFYAVLGIPLT
LVMFQSLGERMNTFVRYLLKRIKRCCGMRNTEVSMENMVTVGFFSCMGTLCIGAAAFSQC
EEWSFFHAYYYCFITLTTIGFGDYVALQTKGALQRKPLYVAFSFMYILVGLTVIGAFLNL
VVLRFLTMNSEDERRDAEERASLAGNRNSMAIHIPEEARQGRPRYKADAADLQSVCSCTC
YRPQEYGGRSAAQQNSFSTKLAPQYFHPISYKIEEISPSTLKNSLFPSPISSVSPGLHSF
TDNHRLMRRRKSI
Download sequence
Identical sequences ENSTTRP00000002689 ENSTTRP00000002689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]