SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002721 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002721
Domain Number 1 Region: 526-847
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 9.98e-109
Family PDEase 0.0000000000132
Further Details:      
 
Domain Number 2 Region: 137-332
Classification Level Classification E-value
Superfamily GAF domain-like 2.18e-44
Family GAF domain 0.0000786
Further Details:      
 
Domain Number 3 Region: 317-521
Classification Level Classification E-value
Superfamily GAF domain-like 5.02e-37
Family GAF domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002721   Gene: ENSTTRG00000002900   Transcript: ENSTTRT00000002902
Sequence length 865
Comment pep:known_by_projection scaffold:turTru1:scaffold_105342:149472:284962:1 gene:ENSTTRG00000002900 transcript:ENSTTRT00000002902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERSGPGSARPQQQWDQDSVEAWLDDHWDFTFSYFVRKGTREMVNAWFAERVHTIPVCKE
GIRGHVESCSCPSEQSPRAESSVPGTPTRKISASEFDRPLRPIVVKDSEGTVSFLSDSEK
KEQMPLTPPRFDNDEGDQCSRLLELVKDISSHLDVTALCHKIFLHIHGLISADRYSLFLV
CEDSANDKFLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGHVAALGEPLNIKDAYEDPR
FNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDEKDFAAYLAFC
GIVLHNAQLYETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIISFMQVQKCTIF
IVDEDCSDSFSSVFHMECEELEKSSDTLTRERDANRINYMYAQYVKNTMEPLNIPDVSKD
KRFPWTNENTGNVKQQCIRSLLCTPIKNGKKNKVIGVCQLANKMEETTGKIKPFNRNDEQ
FLEAFVIFCGLGIQNTQMYEAVERAMAKQMVTLEILSYHASAAEEETRELQSLAAAMVPS
AQTLKITDFSFSDFELSDLETALCTIRMFTDLNLVQNFQMKHEVLCRWILSVKKNYRKNV
AYHNWRHAFNTAQCMFAALKAGKIQNRLTDLEILALLIAALSHDLDHRGVNNSYIQRSEH
PLAQLYCHSIMEHHHFDQCLMILNSPGNQILSGLSIDEYKTTLKIIKQAILATDLALYIK
RRGEFFELIRKNQFNLEDPHQKELFLAMLMTACDLSAITKPWPIQQRIAELVATEFFDQG
DRERKELNIEPADLMNREKKNKIPSMQVGFIDAICLQLYEALTHVSEDCFPLLDGCRKNR
QKWQALAEQQEKTLINGESSQAKRN
Download sequence
Identical sequences ENSTTRP00000002721 ENSTTRP00000002721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]