SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002730 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002730
Domain Number 1 Region: 304-517
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.06e-47
Family DBL homology domain (DH-domain) 0.00023
Further Details:      
 
Domain Number 2 Region: 819-1120
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000000336
Family WD40-repeat 0.021
Further Details:      
 
Domain Number 3 Region: 530-613,707-751
Classification Level Classification E-value
Superfamily PH domain-like 0.0000131
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002730   Gene: ENSTTRG00000002911   Transcript: ENSTTRT00000002911
Sequence length 1279
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_276:96697:209165:1 gene:ENSTTRG00000002911 transcript:ENSTTRT00000002911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSHPPQAAIGDPLLPGGPGPSPEAEDDPGEAFEFDDSDDDDEDTSAGLGVPGAAPEKE
AEDAPLIPLDSAPVADPDLAAAPPQTQEPAVVSNGVAVDTAFSGVRHSSWRRKSSRRIDR
FTFPALEEDVIYDDVPCENLDAHQPGAERKLLYEDVRRDGAPRETEDLGWSSSEFESYSE
DSGEEAKPEAEPAKHRVSFQPKLSPDLTRLKERCARTKRDILALRVGGRDMQELKHKYDY
KMTQLMKAAKSGTRDGLEKTRIAVMRKVSFLHRKDVLGDSEEEDMGLLEVSVTDIKPPAP
ELGPMPDGLSPQQVVRRHILGSIVQSEGSYVESLKRVLQDYRNPLMEMEPKALSVRKCQV
VFFRVKEILHCHSMFQIALSSRVAEWDSTEKIGDLFVASFSKSVVLDVYSDYVNNFTNAM
SIIKKACLTKPFLELKRRQVCSPDRVTLYGLMVKPIQRFPQFILLLQDMLKNTPRGHPDR
LSLQLALTELETLAEKLNEQKRLADQVAEIQQLTKSVSDRSSLNKLLTSGQRQLLLCETL
TETVYGDRGQLIKSKERRVFLLSDMLVCANINFKPANHRGQLEISSLVPLGPKYVVKWNT
ALPQVQVMEVGQEGSSYDKDNVLIQHAGAKKASAAGQAQNKVYLGPPRLFQELQDLQKDL
AVVEQITLLVSTLHGTYQNLNMTVAQDWCLALQRLMRVKEEEIHSANKCRLRLLLPGKPD
KSGRPISFMVVFITPNPLSKISWVNRLHLAKIGLXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXLGALIHSPVSCPLLGFSAVSTSLPQGYLWVGGGQEGAGGQVEIFS
LNRPAPRTVKSFPLVAPVLCMEYIPEPEEEESRDGDKKCSAADASAGVHPTVCLGLQDGS
ILVYSSVDTGTQCLATCRSPGLQPVLCLRHSPFHLFAGLQDGTLAAYPGTSGGVPWDLES
PPVCLTVGPGPVRTLLSLEDTVWASCGPRVTVLDATSLQTQQSFEAHQDAAVSVTHMVKA
GSGVWMAFSSGSSIRLFHTETLEHLQEINIATRTTFLLPGQKHLCVTSLLICQGLLWVGT
DQGVIVLLPVPRLEGIPKITGKGMVSLNGHCGPVAFLAVASSILAPDILRSDQEEAEGPQ
AEEDKPDGQAHEPAPVPASHVGRELTRKKGILLQYRLRSTAHLPGPLLSVREPEPMDGSA
LEHSEEDGSIYEMADDPDVWVRSRPCARDAHRKEICSVAIISGGQGYRSFGGAPGGSGKP
ALCGETDSALLIWQVPLTL
Download sequence
Identical sequences ENSTTRP00000002730 ENSTTRP00000002730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]