SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002733 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002733
Domain Number 1 Region: 2-91
Classification Level Classification E-value
Superfamily PH domain-like 9.97e-22
Family Pleckstrin-homology domain (PH domain) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002733   Gene: ENSTTRG00000002914   Transcript: ENSTTRT00000002914
Sequence length 700
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2629:319104:359817:1 gene:ENSTTRG00000002914 transcript:ENSTTRT00000002914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AWKRRWFVLRSGRLTGDPDVLEYYKNDHAKKPIRIIDLNLCQQVDAGLTFNKKEFENSYI
FDINTIDRIFYLVADSEEEMNKWVRCICDICGFNPTEEDPVKPPGSSLQAPADLPLAINT
APPSTQVDASSAAPPPPYQLISLPPHLETLGIQEDPQDYLLLINCQSKKPEPTRTHADSA
KSTPSETDCNDNVPSHKNPASSQSKHGVNGFFQQQMMYDSPPSRAASISVDSSLYNLPRS
HSHDVLPKVSPSSTEADGELYVFNTPSGTSSVEPQMRHVSISYDIPPTPGNTYQIPRTFP
EGTLGQTSKLDTIPDIPPPRPPKPHPAHDRSPVDTCSITRTASDTDSSYCIPTAGVPPSR
SNTISTVDLNKLRKDASSQDCYDIPRTFPTDRSSSLEGFHNHFKIKNVLTVGSVSSEELD
ENYVPMNPNSPPRQHSSSFTEPIQEANYVPMTPGTFDFSSFGMQVPPPAHMGFRSSPKTP
PRRPVPVADCEPPPVDRNLKPDRKGQSPKILRPKPHGLERTDSQTIGDFATRRKVKPAPL
EIKPLPEWEELQAPVRSPITRSFARDSSRFPMSPRPDSVHSTTSSSDSHDSEENYVPMNP
NLSSEDSNLFGSNSLDGGNSPMIKPKGDKQVEYLDLDLDSGKSTPPRKQKSSVSGSSVAD
ERVDYVVVDQQKTLALKSTREAWTDGRQSTESETPAKNVK
Download sequence
Identical sequences ENSTTRP00000002733 ENSTTRP00000002733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]