SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002758 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002758
Domain Number 1 Region: 301-374
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.1e-31
Family PDEase 0.00041
Further Details:      
 
Domain Number 2 Region: 5-42,69-218
Classification Level Classification E-value
Superfamily GAF domain-like 1.14e-30
Family GAF domain 0.0008
Further Details:      
 
Domain Number 3 Region: 473-598
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.00000000000000135
Family PDEase 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002758   Gene: ENSTTRG00000002928   Transcript: ENSTTRT00000002942
Sequence length 619
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1319:6472:20135:1 gene:ENSTTRG00000002928 transcript:ENSTTRT00000002942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLLWSANKVFEELTDIERQFHKAFYTVRAYLNCDRYSVGLLDMTKEKEFFDVWPVLMGEA
PPYSGPRTPDGREIVFYKVIDYILHGKEDIKVIPSPPADHWALASGLPTYVAESGFICNI
MNAQADEMFKFQEGPLDDSGWVIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDEQDELL
MESLTQFLGWSALNADTYDKMNRLENRKDIAQDMVLYHVRCDRDEIQLILPTRERLGKEP
AECEEDELGRILXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XVLVRFLFSVSKGYRRITYHNWRHGFNVAQTMFTLLMTGKLKSYYTDLEAFAMMTAGLCH
DIDHRGTNNLYQMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAMMMTAC
DLSAITKPWEVQSKVALLVAAEFWEQGDLERTVLDQQPIXXXXXXXXXXXXXXXXXXXXX
XXXXXXXEFSRFHEEILPMFDRLQNNRKEWKTLADEYEVKVKALEEEQRKEAERTAAKKA
GTEVCNGGPAPQSSTCCIL
Download sequence
Identical sequences ENSTTRP00000002758 ENSTTRP00000002758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]