SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002791 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002791
Domain Number 1 Region: 576-926
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.1e-107
Family PDEase 0.00000232
Further Details:      
 
Domain Number 2 Region: 388-571
Classification Level Classification E-value
Superfamily GAF domain-like 3.71e-49
Family GAF domain 0.0000000656
Further Details:      
 
Domain Number 3 Region: 219-402
Classification Level Classification E-value
Superfamily GAF domain-like 5.02e-35
Family GAF domain 0.0000000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002791   Gene: ENSTTRG00000002959   Transcript: ENSTTRT00000002975
Sequence length 936
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3183:45795:137377:-1 gene:ENSTTRG00000002959 transcript:ENSTTRT00000002975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQACGHSILCRSQQYPAARPAEPRGQQVFLKPDEPPPPQPCADSLQDALLSLGSVIDIA
GLQWAVKEALSAVLPRVETVYTYLLDGESRLVCEEPPHELPQEGKVRXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXLVIPLVDKEAGAVAAVILVHCGHLSDSEEWSLQAVE
KHTLLKRQLQQRPSAAPEAVQNTPEGAAGDQKGGVPYTDQDRKIVQLCGELYDLDASSLQ
LKVLQYLQQETQASRCCLLLVSEDSLQLSCKVIGDKVLEEEISFPLTMGRLGQVVEDKKS
IQLKDLTSEDVQQLQSMLGFEVQAMLCIPVISRATDQVVALACTFNKLGGDLFTDQDERV
IQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLS
NAEICSVFLLDQNELVAKVFDGGVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHP
LFYRGVDDSTGFRTRNILCFPIKNENKEVIGVAELVNKINGPWFSKFDEDLATAFSIYCG
ISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFACFTY
TPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVS
HFCYLLYKNLELANYLEDMEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSV
MERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAE
VGYDRTNKQHHSLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPM
EMMDREKAYIPELQISFMEHIAMPIYKLLQDLFLKAAELYERVASNREHWTKVSHKFTIR
GLPSNNSLDFLDEEYEVPDLDGAGAPINGCCSLDAE
Download sequence
Identical sequences ENSTTRP00000002791 ENSTTRP00000002791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]