SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002865 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002865
Domain Number 1 Region: 5-364
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.97e-133
Family Motor proteins 0.0000000000195
Further Details:      
 
Domain Number 2 Region: 531-636
Classification Level Classification E-value
Superfamily SMAD/FHA domain 3.73e-28
Family FHA domain 0.00000823
Further Details:      
 
Domain Number 3 Region: 1603-1646,1695-1792
Classification Level Classification E-value
Superfamily PH domain-like 4.38e-25
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002865   Gene: ENSTTRG00000003050   Transcript: ENSTTRT00000003051
Sequence length 1818
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2697:557413:688508:1 gene:ENSTTRG00000003050 transcript:ENSTTRT00000003051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGASVKVAVRVRPFNSRETSKESKCIIQMQGNSTSIINPKNPKEAPKSFSFDYSYWSHT
SPEDPCFASQNRVYNDIGKEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQEESQAGIIP
QLCEELFEKINDNCNEEMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVED
LSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQKKHDTETNLSTEK
VSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVDNCTSKSKKKKK
TDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIKCNAVI
NEDPNAKLVRELKEEVTRLKDLLRAQGLGDIIDTDPLIDDYSGSGGKYLKDFQNNKHRYL
LASENQRPGNFSTASMGSLTSSPSSCSLNSQVGLTSVTSIQERIMSTPGGEEAIERLKXX
XXXXXXXXXXXXXXXXXXXXXXXXXEALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNED
PLMSECLLYYIKDGITRVGQADAERRQDIVLSGAHIKEEHCIFRSERNNSGDVIVTLEPC
ERSETYVNGKRVAQPVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPSEPVDWT
FAQRELLEKQGIDMKQEMEKRLQEMEILYKKEKEEADLLLEQQRLDYESKLQALQKQVET
RSLAAETTEEEEEEEEVPWTQHEFELAQWAFRKWKSHQFTSLRDLLWGNAVYLKEANAIS
VELKKKVQFQFVLLTDTLYSPLPPELLPTEMEKTQEDRPFPRTVVAVEVQDLKNGATHYW
SLAKLKQRLDLMREMYDRAGEMASSAQDESETTMTGSDPFYDRFHWFKLVGSAPIFHGCV
NERLADRTPSPTFSTADSDITELADEQQDEMEDFDDEAFVDDTGSDAGTEEGSDLFSDGH
DPFYDRSPWFILVGRAFVYLSNLLYPVPLIHRVAVVSEKGEVRGFLRVAVQAIAADEEAR
DYGSGIRQSGTAKISFDNEYFNQSDFSSVAMTRSGLSLEELRIVEGQGQSSEVITPPEEI
NRMNDLDLKSGTLLDGKMVMEGFSEEIGNHLKLGSAFTFRVTVLQASGILPEYADIFCQF
NFLHRHDEAFSTEPLKNNGRGSPLGFYHVQNXXXXXXXXXVDYIKTKPIVFEVFGHYQQH
PLLQGQELNSPPQPSRRFFPPPMPLSKPVPATKLNTMSKTSLGQSMSKYDLLVWFEISEL
EPTGEYIPAVVDHTAGLPCQGTFLLHQGIQRRITVTIIHEKGSELHWKDVRELVGXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFYRFEAVWDSSLHNSLLLNRVTPYGEKI
YMTLSAYLELDHCIQPAVITKDVCMVFYSRDAKISPPRSLRSLFGSGYSKSPDSNRVTGI
YELSLCKMADTGSPGMQRRRRKILDTSVAYVRGEENLAGWRPRGDSLILEHQWDLEKLEL
HEVEKTRHFLLLRERLGDSIPTSLSDSLSPSLSSGTLSTSTSISSQISTTTFESAITPSE
SSGYDSTDIESLVDREKELATKCLQLLTHTFNREFGQVHGSISGCKLSDISPVGRDPSVS
SFSSATLTPSSTCPSLIDARGNSLDQKTPEANSQASSPCPEFEQFQIVPTVETPYLARAG
KNEFLNLVPDEEIRPGSVVSKKGYLHFKEPLSSNWAKHFVVVRRPYVFIYNSDKDPVERG
IINLSTAQVEYSEDQQAMVKTPNTFAVCTKHRGVLLQALNDKDMNDWLYAFNPLLAGTIR
TGRLLPEAIVEDSFSFSC
Download sequence
Identical sequences ENSTTRP00000002865 ENSTTRP00000002865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]