SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002888 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002888
Domain Number 1 Region: 398-684
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 5.49e-82
Family Oxysterol-binding protein 0.00039
Further Details:      
 
Domain Number 2 Region: 26-114,145-264
Classification Level Classification E-value
Superfamily PH domain-like 1.34e-23
Family Pleckstrin-homology domain (PH domain) 0.0000045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002888   Gene: ENSTTRG00000003078   Transcript: ENSTTRT00000003078
Sequence length 886
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2972:38400:169104:-1 gene:ENSTTRG00000003078 transcript:ENSTTRT00000003078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAGLADGEPDRTLLLGDSKDVLGPSTVVANSDDTQHLTPGKMSQRQGKEAFPTPTKDLY
QPCFSPASPHSQGFERGKEDISQNKDESSLSMSKSKSESKLYNGSEKDSSASSKLTKKES
LKVQKKNYREEKKRATKELLSTITDPSVIVMADWLKIRGTLKSWTKLWCVLKPGVLLIYK
TQKNGQWVGTVLLNACEIIERPSKKDGFCFKLFHLEXXXXXXXGPKGEAVGSITQPLPSS
YLIIRATSESDGRCWMDALELALKCSSLLKRTMIREGKEHDLSISSESTHVTLYGLLRAN
SLHSGDNFQLNDSEIERQHFKDQDMYSDKSDKENDQEHDESDNEVMGKSEESDTDTSERQ
DDSYIEPEPVEPLKETTYTEQSHEELGEAGEASQTETVSEENKSLIWTLLKQVRPGMDLS
RVVLPTFILEPRSFLDKLSDYYYHADFLSEAALEENPYFRLKKVVKWYLSGFYKKPKGLK
KPYNPILGETFRCLWIHPRTNSKTFYIAEQVSHHPPISAFYVSNRKDGFCLSGSILAKSK
FYGNSLSALLEGEARLTFLNRGEDYAMTMPYAHCKXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXPFLGSSDCVNQISGKLKLGKEVLATLEGHWDSEVFITDKKTDNSEVFWNPTP
DIKQWRLIRHTVKFEEQGDFESEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXTRPWDPLNDMIQYEKDGVIQTKVKHRTPMVSVPK
MKHKPTRQQKKAKGYSSPXXXXXXXXXXXXQSVKPSARRKKGIELGDIQTSIESIKQTQE
EIKRNIMALRHLISSTPATDYFLQLKDYFIIFLLILLQVIINFMFK
Download sequence
Identical sequences ENSTTRP00000002888 ENSTTRP00000002888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]