SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002892 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002892
Domain Number 1 Region: 374-520
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.56e-24
Family Regulator of G-protein signaling, RGS 0.0029
Further Details:      
 
Domain Number 2 Region: 576-682
Classification Level Classification E-value
Superfamily PX domain 3.53e-23
Family PX domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002892   Gene: ENSTTRG00000003083   Transcript: ENSTTRT00000003083
Sequence length 969
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_245:270472:367220:-1 gene:ENSTTRG00000003083 transcript:ENSTTRT00000003083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNIFKITETSLSIWGWGSLGIVLSLITFGPFVIFYLAFYILCFVGGGFVVTLLFGKTNSE
KYLEQCEHSFLPPTSTGIPKCLEEMKREARTIKIDRRLTGANIIDEPLQQVIQFSLRDYV
QYWYYTLSDDESFLLEIQTLQNALIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFLRDLCEVLLYLLLP
PGDFQNKIMRYFVREILARGILLPLINQLSDPDYINQYIIWMIRDSNCNYEAFMNIIKLS
DNIGELEAVRDKAAEELQYLRSLDTAGDDINTIKNQINSLLFVKKVCDSRIQRLQSGKEI
NTVKLAANFGKLCTVPLDSILVDNVALQFFMDYMQQTGGQAHLFFWMTVEGYRVTAQQQL
EVLSSRQKDGRHQTNQTKGLLRAAAVGIYEQYLSEKASPRVTVDDYLVAKLADTLNHEDP
TPEIFDDIQRKVYELMLRDERFYPSFRQNALYVRMLAELDMLKDPSFRGSDDGDGESFNG
SPTGSINLSLDDLSNVSSDDSVQLHAYISDTVYADYDPYAVAGVCNDHGKTYALYAITVH
RRSLNSEEMWKTYRRYSDFHDFHMRITEQFENLSSILKLPGKKTFNNMDRDFLEKRKKDL
NAYLQLLLTPEMMKASPALAHYVYDFLEKAYSKGKGFARXMDTFVNPLRNSMRNVSNAVK
SLPDSFAEGMTKMSDNMGKMSERLGQDIRQSFFKVPPLIPKTDSDPEHCRVSAQLDDTVD
DNIPLRVMLLLMDEVFDLKERNQWLRRNIKNLLQQLIRATYGDTINRKIVDHVDWMTSPE
QVADLVKRFRDAFWPNGILAETVPCRDKAIRMRTRVAGKTKLLSIMPDELKHIIGAETTR
KGILRVFEMFQHNQLNRRMVYVFLEGFLESLFPQYKFRELFNRLHSRSKQMQKYKQKLHT
TQAPSLQKR
Download sequence
Identical sequences ENSTTRP00000002892 ENSTTRP00000002892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]