SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002927 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002927
Domain Number 1 Region: 99-272
Classification Level Classification E-value
Superfamily Sec7 domain 9.29e-71
Family Sec7 domain 0.0000000157
Further Details:      
 
Domain Number 2 Region: 281-393
Classification Level Classification E-value
Superfamily PH domain-like 4.93e-28
Family Pleckstrin-homology domain (PH domain) 0.00000824
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002927   Gene: ENSTTRG00000003123   Transcript: ENSTTRT00000003124
Sequence length 415
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_741:45809:125863:-1 gene:ENSTTRG00000003123 transcript:ENSTTRT00000003124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVLGQELRVGRAVNPSESGSGTLDDDSYFPSDLTAEERQELENIRRRKQELLADIQRLKD
EIAEVANEIENLGSTEEXXXXXXXXXXXXXXXXXXXXXXXGIQFLIENDLLKNTCEDIAQ
FLYKGEGLNKTAIGDYLGERDEFNIQVLHAFVELHEFTDLNLVQLRQFLWSFRLPGEAQK
IDRMMEAFAQRYCQCNHGVFQSTDTCYVLSFAIIMLNTSLHNPNVKDKPTVERFIAMNRG
INDGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLAGGRVKTWKR
RWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIACKT
EADGRVVEGHTVYRISAPTPEEEDWIKCIKAAISRDPFYEMLAARKKKVSSTKRH
Download sequence
Identical sequences ENSTTRP00000002927 ENSTTRP00000002927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]