SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003035 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003035
Domain Number 1 Region: 412-805
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.57e-117
Family Oxysterol-binding protein 0.0011
Further Details:      
 
Domain Number 2 Region: 79-191
Classification Level Classification E-value
Superfamily PH domain-like 7.19e-27
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003035   Gene: ENSTTRG00000003234   Transcript: ENSTTRT00000003237
Sequence length 805
Comment pep:known_by_projection scaffold:turTru1:scaffold_97797:1034:33093:1 gene:ENSTTRG00000003234 transcript:ENSTTRT00000003237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATELRGVVGPGPAAIAAPGGGGGGAGPPMVGGGGAGGRGDSGPSSGIAPGTVAAVAAG
GPGPGAGGVAAAGSAPAPPAGGSGAGGSGSAREGWLFKWTNYIKGYQRRWFVLSNGLLSY
YRSKAEMRHTCRGTINLATANITVEDSCNFIISNGGAQTYHLKASSEVERQRWVTALELA
KAKAVKMLAESDESGDESVSQTDKTELQTLRTLSSKXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXACRDFLVLAQTHSKKWQKSLQYERDQR
IRLEETLEQLAKQHNHLERAFRGATVLPANAPGGAASGKGQCCSGKGDVSDEDDENEFFD
APEIITMPENLGHKRTGSNISGASSDISLDEQYKHQLEETKKEKRTRIPYKPNYSLNLWS
IMKNCIGKELSIPMPVNFNEPLSMLQRLTEDLEYHELLDRAAKCENSLEQLCYVAAFTVS
SYSTTVFRTSKPFNPLLGETFELDRLEENGYRSLCEQVSHHPPAAAHHAESKNGWTLRQE
IKITSKFRGKYLSIMPLGSIHCIFHATGHHYTWKKVTTTVHNIIVGKLWIDQSGEIDIVN
HKTGDKCNLKFVPYSYFSRDVARKVTGEVTDPSGKVHFALLGTWDEKMECFKVQPVIGEN
GGDARQRGHEAEESRVMLWKRNPLPKNAENMYYFSELALTLNAWEAGTAPTDSRLRPDQR
LMENGRWDEANAEKQRLEEKQRLSRKKREAEAMKATEDGTPYDPYKALWFERKKDPVTKE
LTHIYRGGYWECKEKQDWSSCPDIF
Download sequence
Identical sequences ENSTTRP00000003035 ENSTTRP00000003035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]