SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003059 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003059
Domain Number 1 Region: 61-246
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.0000000000000304
Family Brix domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003059   Gene: ENSTTRG00000003262   Transcript: ENSTTRT00000003262
Sequence length 353
Comment pep:known_by_projection scaffold:turTru1:scaffold_92856:43948:52100:-1 gene:ENSTTRG00000003262 transcript:ENSTTRT00000003262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVAKRKRRGGPAFQAKKLKRNEKDAKTRAKPSDVAEEAAEAERDRIPGPVCKGKWKNKE
RILIFSSRGINFRTRHLMQDLRMLMPHSKADTKMDRKDKLFVINEVCEMKNCNKCIYFEA
KKKQDLYMWLSNSPHGPSAKFLVQNIHTLAELKMTGNCLKGSRPLLSFDPAFDELPHFAL
LKELLIQIFSTPRYHPKSQPFVDHVFTFTILDNRIWFRNFQIIEEDAALVEIGPRFVLNL
IKIFQGSFGGPTLYENPHYQSPNMHRRVIRSITAAKYREKQQVKDVQKLRKKEPKTILPH
DPTADVFVIPAEEKPIEIQWVKPEPKVDLKARKKRIYKRQRKMKQKMNSGNAK
Download sequence
Identical sequences ENSTTRP00000003059 ENSTTRP00000003059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]