SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003073 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003073
Domain Number 1 Region: 266-476
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.79e-56
Family DBL homology domain (DH-domain) 0.00033
Further Details:      
 
Domain Number 2 Region: 569-684
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.44e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0038
Further Details:      
 
Domain Number 3 Region: 458-542
Classification Level Classification E-value
Superfamily PH domain-like 9.59e-16
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003073   Gene: ENSTTRG00000003275   Transcript: ENSTTRT00000003276
Sequence length 708
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2151:19242:36583:-1 gene:ENSTTRG00000003275 transcript:ENSTTRT00000003276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHQGNRILVKSLSLDPGQSLEPHPEGPQRLRSDPGPPTETPSQRPSPLKRAPGPKPQVPP
KPSYLQMPRMPPPPEPIPPPPSRPLPADPRVAKGLASRAEASLSSAAVSSLIEKFEREPV
IVASDRPAPGPSPGPAEPATLPQPPLQPPVPQLPESEASRCLFLLAPGPRDGEVPNRDSG
IDSISSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXLTVQQKVFHIANELLQTEKAYVSRLHLLDQVFCARLL
EEARNRSSFPADVVHGIFSNICSIYCFHQQFLLPELEKRMEEWDRYPRIGDILQKLAPFL
KMYGEYVKNFDRAVELVNTWTERSTQFKVIIHEVQKEEACGNLTLQHHMLEPVQRIPRYE
LLLKDYLLKLPHGSPDSKDAQKSLELIATAAEHSNAAIRKMERMHKLLKVYELLGGEEDI
VSPTKELIKEGHILKLSAKNGTTQDRYLILFNDRLLYCVPRLRLLGQKFSVRARIDVDGM
EXXXXXXXXXXXXXXXXXXXXXXXXXXXTEEEKKDWVQAINSTLLKHEQTLETFKLLNST
NREDEDTPPNSPNVDLGKRAPTPIREKEVTMCMRCQEPFNSITKRRHHCKACGHVVCGKC
SEFRARLVYDNNRSNRVCTDCYVALHGVPGSSPACSQHTPQRRRSILE
Download sequence
Identical sequences ENSTTRP00000003073 ENSTTRP00000003073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]