SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003105 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003105
Domain Number 1 Region: 11-147
Classification Level Classification E-value
Superfamily Nudix 2.17e-24
Family MutT-like 0.00000275
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003105   Gene: ENSTTRG00000003309   Transcript: ENSTTRT00000003309
Sequence length 181
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2785:94905:108746:1 gene:ENSTTRG00000003309 transcript:ENSTTRT00000003309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPG
GAAVREVYEEAGVKGKLGRLLGIFEQNQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREW
FKVEDAIKVLQCHKPVHAEYLEKLKLGCSPTNGNSTVPSLPDNNTLFVTAAQTSGLPSSV
R
Download sequence
Identical sequences M3X267
ENSTTRP00000003105 ENSTTRP00000003105 XP_006735520.1.47382 XP_006934015.2.62641 XP_019301970.1.44245 XP_021543002.1.83697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]