SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003125 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003125
Domain Number 1 Region: 369-675
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.29e-89
Family Protein kinases, catalytic subunit 0.000000188
Further Details:      
 
Domain Number 2 Region: 226-343
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.98e-34
Family cAMP-binding domain 0.00069
Further Details:      
 
Domain Number 3 Region: 95-218
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.01e-30
Family cAMP-binding domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003125   Gene: ENSTTRG00000003329   Transcript: ENSTTRT00000003333
Sequence length 686
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3144:138475:1239744:1 gene:ENSTTRG00000003329 transcript:ENSTTRT00000003333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQA
QKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMK
NLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKV
FGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLRSVPTFQNL
PEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGKVNVTREDSPSEDPVFLRTLG
KGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKY
EAEAAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEH
IRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYT
ACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYV
APEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAK
NAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTD
TSNFDSFPEDNDEPPPDDNSGWDVDF
Download sequence
Identical sequences ENSTTRP00000003125 XP_004285399.1.21590 ENSTTRP00000003125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]