SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003132 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003132
Domain Number 1 Region: 69-128
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-21
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 2 Region: 5-66
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000131
Family Complement control module/SCR domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003132   Gene: ENSTTRG00000003345   Transcript: ENSTTRT00000003340
Sequence length 134
Comment pep:novel scaffold:turTru1:scaffold_102896:198203:223639:1 gene:ENSTTRG00000003345 transcript:ENSTTRT00000003340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPSHTCGNPGEILKGVLHGTRFNIGDKIRYSCLSGYILEGHAILTCIVSPGNGASWDFPA
PFCRAEGACGGTLRGTSGSISSPYFPSEYENNADCTWTILAEPGDTIALVFTDFQLEEGY
DFLEISGTEAPSIW
Download sequence
Identical sequences ENSTTRP00000003132 ENSTTRP00000003132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]