SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003133 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003133
Domain Number 1 Region: 432-640
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.24e-43
Family DBL homology domain (DH-domain) 0.0004
Further Details:      
 
Domain Number 2 Region: 116-260
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-41
Family Third domain of FERM 0.00023
Further Details:      
 
Domain Number 3 Region: 771-919
Classification Level Classification E-value
Superfamily PH domain-like 5.09e-33
Family Pleckstrin-homology domain (PH domain) 0.003
Further Details:      
 
Domain Number 4 Region: 16-118
Classification Level Classification E-value
Superfamily Second domain of FERM 5.89e-28
Family Second domain of FERM 0.00012
Further Details:      
 
Domain Number 5 Region: 628-748
Classification Level Classification E-value
Superfamily PH domain-like 3.34e-23
Family Pleckstrin-homology domain (PH domain) 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003133   Gene: ENSTTRG00000003338   Transcript: ENSTTRT00000003341
Sequence length 936
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1999:21996:101993:1 gene:ENSTTRG00000003338 transcript:ENSTTRT00000003341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKHVVVKFVVKFFPPDHTQLQEELTRYLFALQVKQDLAQGRLTCSDTSAALLVSHIVQSE
IGDFDEASDREHLAKNKYIPQQDALEDKIVEFHHNHIGQTPAESDFQLLEIARRLEMYGV
RLHPAKDREGTKINLAVANTGILVFQGFTKINAFNWAKVRKLSFKRKRFLIKLRPDVNSS
YQDTLEFLMASRDFCKSFWKICVEHHAFFRLFEEPKPKPKPVLFSRGSSFRFSGRTQKQV
LDYVKEGGHKKVQFERKHSKIHSIRSLATQPAEPNSEVPKQAQQRASLTFGEGAASPGGQ
SCQPGRDPPASADERGPQRNPTPQRSPAGSTKADGAGRAETEEEEEVAKDRTQQSRPRPP
QPSTGSLTGSPHLSELSINSQGGAAPTSTVLSPNLSPDTKQASPLVSPLLNDQAGPRTDD
EDDGRRKRFPTDKAYFIAKEVSTTERTYLKDLEVITSWFQSTVSKEDSMPETLKSLIFPN
FEPLHKFHTNFLKEIEQRLALREGRSNAHIRGDYQRIGDVLLKNIQGMKQLAAHLWKHSE
ALEALETGIRGSRRLESLCRDFELQKVCYLSLNTFLLRPLHRLMHYKQVLERLCKHHPPS
HTDFRDCRAALAEITEMVAQLHGTMIKMENFQKLHELKKDLIGVDNLVIPGREIRLGSSK
LSGKGLQQRMFFLFNDVLLYTSRGLTASNQFKVHGQLPLYGMTMEESEDEWGVPHCLTLR
GQRQSIVVAASSRSEMEKWVEDIQMAIDLAEKSSGPAPEFLASSPPDSKSPEEAAGDQES
EDDLSASRTSLERQAPHRGNTMVHVCWHRNTSVSMVDFSVAVENQLSGNLLRKFKNSNGW
QKLWVVFTNFCLFFYKSHQDSHPLASLPLLGYSLTIPSESEDLHKDYVFKLHFKSHVYYF
RAESEYTFERWMEVIRSATSSASRAHVLSHKESHVY
Download sequence
Identical sequences ENSTTRP00000003133 ENSTTRP00000003133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]