SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003188 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003188
Domain Number 1 Region: 635-821
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.84e-52
Family DBL homology domain (DH-domain) 0.000000209
Further Details:      
 
Domain Number 2 Region: 829-957
Classification Level Classification E-value
Superfamily PH domain-like 8.69e-35
Family Pleckstrin-homology domain (PH domain) 0.0000159
Further Details:      
 
Domain Number 3 Region: 349-465
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000417
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 4 Region: 136-229
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000327
Family CRAL/TRIO domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003188   Gene: ENSTTRG00000003399   Transcript: ENSTTRT00000003400
Sequence length 1063
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_559:48659:146158:-1 gene:ENSTTRG00000003399 transcript:ENSTTRT00000003400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APRTPAPQSPAPGGRTPGLPWDPDSCAFVPATQAISLQVDMAMALQRVRISDKYGKSYLC
LLQAVFLAETEVLLRVKDISHFLMQDIAFLSGGRGKDNAWIITFPENCNFRCIPEEVIAK
VLTYLTSVARQNESDSRFTIILDRRLDTWSSLKISLQKISASFPGNLHLVLVLRPTSFLQ
RTFTDIGFRFSQEDFILKLPVVMLSSVSDLLTYIDDEQLTPELGGTLQYCHSEWIIFRNA
IENFALTVKDMAQMLQSFGTELAETELPDDIPAIEEILATRAERYHLLKKDITTVTKEGK
ILLTNLEVPDAEDAVSSRLENHQQICGDWQTINKLLTQVHDMEIAFDGFWEKHQLKMEQY
LQLWKFEQDFQELVSEAELLLNQQAELADVTGNIAQVKQKIKKLENLDENSQDLLAKAQF
VILHGHRLAASHHYALDLICQRCNELRYLSDILVNEIKTKRIQLSRTFKMHKILQQAHQC
CDEGECLLANQEINKFQSKKDAQRALQDMETFLEMAAPFINYDPEALQYEFDMILSPELK
VQMQTIQLKLENLRSIFENQQAGFRNLTDKHVRPIPSVVPASDSLIRSREPFFSPEQGRK
TWRQNQSNIKIEVVQDCQEKRSSAQSSSLDNDNSLDILKNHVLNELVQTEKVYVRELFAV
LLGYREEMDNPEMFDLIPPLLRNKKDVLFGNMAEIYEFHSNIFMSSLEDCVVAPERVGPC
FLERKDDFQMYAKYCQNKPKSEAIWKKYSECAFFQECQRKLKHRLGLDSYLLKPVQRITK
YQLLLKELLKYSKDCEGSVQLKEALDMILDLLKSVNDSMHQIAINGYIGNLNELGKMITQ
GAFSVWIGHKKGATKMKDFARFKPMQRHLFLYEKAIVFCKRRVESREGSDRYPSYSFKHC
LKMDEVGITEYVKGDDRKFEIWYAGKEEVYIVQASNVDVKMMWLKEIRSILLKQQELMTV
KKQEQHNQLTEQNLSSQRNERQQGAFIGAEETDLAHTSTMVEVDEAIASVRAEANTVWTE
MSSPSEIPVEPEEWPSNYFYSSCDDNEEERPLMRPVSEMAVLF
Download sequence
Identical sequences ENSTTRP00000003188 ENSTTRP00000003188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]