SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003216 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTTRP00000003216
Domain Number - Region: 151-306
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 0.001
Family Penicillin V acylase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003216   Gene: ENSTTRG00000003428   Transcript: ENSTTRT00000003428
Sequence length 403
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_759:493931:531752:-1 gene:ENSTTRG00000003428 transcript:ENSTTRT00000003428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PISRKVRGSTWTFHLCLSARTEAILCLVSSAAKVWTEDCRKSTYPPSGPTXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGLLGNFPGPF
EEEMKGIAAVTEIPLGEIISFNIFYEFFTICTSIITEDKEGHLLHARNMDFGVFLGWNVN
NNTWVVTEELKPLTVNLDFQRNNKTVFKAAGFAGYVGMLTGFKPGLLSLTLNERFSTNGG
FMGVIEWILGKKDAKWIGFIIRSVLENSTSYEEAKTILTKTKVLAPAYFILGGNKSGEGC
VITRDREQSLDIYELDPKQGIWYVVQTNYDRWKNPFFLDNRRTPAKMCLNQTTQENISFA
TMYDVLSTKPVLNKLTVYTALIDVTKGQFETYLRDCPDPCIGW
Download sequence
Identical sequences ENSTTRP00000003216 ENSTTRP00000003216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]