SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003219 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003219
Domain Number 1 Region: 263-483
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-54
Family DBL homology domain (DH-domain) 0.0000839
Further Details:      
 
Domain Number 2 Region: 620-682
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000112
Family SH3-domain 0.0019
Further Details:      
 
Domain Number 3 Region: 517-621
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000767
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003219   Gene: ENSTTRG00000003431   Transcript: ENSTTRT00000003431
Sequence length 705
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1663:268690:281722:1 gene:ENSTTRG00000003431 transcript:ENSTTRT00000003431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQQHSDSSLEEKLLEHRFHSELQLDTEGNPASRLPMVRGPLQSRSNAAFQPDTPVPPSP
LRPEPRTIVLSTQSPAALKMGTQQLIPRSLAVSSKAKTPARHQSFGAAMLSKEAARRDPR
LLPAPSFSLDDMDVDTGPGGMLRRNLRNQSYRAAMKGLGTPSGEGGPVQLSPKIRALTEE
PSQPPARSTARNKKTLGRKRAHKGSFKDDPRFYQEIRERGLNTIHESDDDLLDESSSPEE
TQKADACIVVKSYRPPQVTWSQLPEVVESGILDKLPAEEHERQEAIFEILISEFSYQHSL
GILVAEFLQSRELRATMTQTEHHHLFSNITDVLSASQRFFEDLEKRHRAQVCVEDVSDIL
EEHAERHFHPYVSYCSNEVYQQRALQQLTSSSAAFREALREIEQRPACGGLPMISFLILP
MQRVTRLPLLTDTLCLKTQGHPERYKAASRALKAISKLVKQCNEGAHRMERMEQMYTLHT
QLDFSKVKXXXXXXXXXXXXXXXXXXXXXXXGLSGNSACRRTCYFLFNDVLVVTKKKSED
SFVVQDYAQLDHIQVQKMEPSEASLPGGGNRSSFVPHTFQLTLLHNSEGRQEKILLSSDS
ASDRARWITALTHWERRQPDPTNKGDLLQVEITKAYLAKQADEITLQQADVVLVLEQEDG
WLYGERLRDGETGWFPEDLARSITSRVAVEGNMRRMERLRVETDV
Download sequence
Identical sequences ENSTTRP00000003219 ENSTTRP00000003219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]