SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003281 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003281
Domain Number 1 Region: 226-538
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.23e-60
Family N-type ATP pyrophosphatases 0.00000287
Further Details:      
 
Domain Number 2 Region: 1-191
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 5.15e-42
Family Class II glutamine amidotransferases 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003281   Gene: ENSTTRG00000003498   Transcript: ENSTTRT00000003499
Sequence length 561
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_240:51059:67434:-1 gene:ENSTTRG00000003498 transcript:ENSTTRT00000003499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDQLFGMQ
PIRVKKYPYLWLCYNGEIYNHKKLQHHFEFEYQTKVDGEIILHLYDKGGIEQTVCMLDGV
FAFILLDTANKKVFLGRDTYGVRPLFKAVTEDGFLAVCSEAKGLINLKHSMTPFLKVEPF
LPGHYEVLDLKPNGKVASVEMVKYHNCRDEPLHALYDSVEKLFPGFEIETVKNNLRILFD
NAIKKRLMTDRRIGCLLSGGLDSSLVAAILLKQLKEAKVQYPLQTFAIGMEDSPDLLAAR
KVANHIGSEHHEVLFNSEEGIQVLDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVV
IFSGXXXXXXXXXXXXXXXAPSPEKAEEESERLLKELYLFDVLRADRTTAAHGLELRVPF
LDHRFSSYYMSLPPNMKTPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNS
WFRILQEYIDHQVDDAVMASAAQKFAVNPPKTKEGYYYRQIFERHYPGRADWLPHYWMPR
WTSATDPSARTLTHYKATAKA
Download sequence
Identical sequences ENSTTRP00000003281 ENSTTRP00000003281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]