SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003343 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003343
Domain Number 1 Region: 52-262
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.71e-55
Family DBL homology domain (DH-domain) 0.0000413
Further Details:      
 
Domain Number 2 Region: 247-352
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-17
Family Pleckstrin-homology domain (PH domain) 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003343   Gene: ENSTTRG00000003566   Transcript: ENSTTRT00000003566
Sequence length 1345
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3071:163044:171115:1 gene:ENSTTRG00000003566 transcript:ENSTTRT00000003566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPRGSGSSTSLSTVGSEGDPAPGPTPACLASRPEPLPGPPIRLHLSPVGTPASAKPSR
LERVAREIVETERAYVRDLRSIVEDYLGPLLDGGVLGLSAEQVGTLFANIEDIYEFSSEL
LEDLEGSSSAGGIAECFVQRSEDFDIYTLYCMNYPSSLALLRELSVSPPAALWLQERQAQ
LHHSLPLQSFLLKPVQRILKYHLLLQELGKHWVEGPDAGGRELVEEAIVSMTAVAWYIND
MKRKQEHAARLQEVQRRLGGWTGPELSAFGELVLEGAFRGGGGGGPRLRGGERLLFLFSR
MLLVAKRRGPEYTYKGHIFCCNLSVTESPRDPLGFKVSDLTIPKHRHLLQAKXXXXXXXX
XXXXXXXXXXXXXXXXXXXAKQVLLENSLHCAPKSKSIPEPLTPPLGSPRPRDARSFTPG
RRNTAPSPGPATTRRGRRQSEPLKDPYVMFPQNAKPRLKHTGSEGELYPPLEPLPPVPAS
EPPEDLEDTGPPTLDPSGTSITEEILELLNQRGLRDPGPPPHDIPKFPGDSQVPGDSDTL
AFQALPSRDSSEEEEEEELDTDERGPSPLHVLEGLESSIAAEIPDIPSLSKSPDVPNLPE
IPSLSEIPQMPRLPSLSDISSVFEMPCLPAIPSVPDIPSLSNAPTLPCDSWLQGPLQEPD
EALATRRELFPGSSSGKLGEPSSESRAGQEEGEGVSYPAFQPRDVTQGQEFPDELEFRPC
SEIRSAWRALEQGQPARPGFPEPLLILEDSDLSGGSGSGKAGAPTSERSASRVRELARLY
SERIQQMQRAETRASANAPRRRPRALAQPQLLPCLPREQAEPGPLPAFGHVLVCELAFSL
TCAQESVPLSPAAQVQAATAVTKQRGCLDGQRLNVSSLPEQHHLGIQVPAATPLPEQGGL
WNIRIPATTPLPKQEDPPNGQMPAITTLPDQEGHPEIQVPAATPLPEHRGHVDIPVPSTT
SFPEQGCHVDIQVPITPALPKRGSCSDVMALAATPTPKREGHLDSQSSTNTPLTKQGDSR
AVQSPATACGQAVDPLLIHRSSLDPQIPADTPVPLQHDLPDIQVPGTSPLPAPGGHLDHQ
TPANTLPSLPRDLPHFQVPAAVPSPQPQGLTDTQVQALPPLPQQGGLPDIQGPAAAPLLE
EQSLTDLQGQKLTPLLEQKSLTNDHVPAAPPLPEQGGPRDIQGLLPTRVQTTVVLSKQGG
HAVSHVARSESSDLSPPHSPPLTTRQLLGSNAAALSRYLAASYISQSLARRQGPGGEAPP
ASRGPWPSSAPTSRAPSPPPQPQPPAPPARRLSYATTVNIHVGGGGRLQPAKAQVRLNHP
ALLATPQESVGLRRAQGAPDAPFHM
Download sequence
Identical sequences ENSTTRP00000003343 ENSTTRP00000003343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]