SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003374 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003374
Domain Number 1 Region: 210-398
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.38e-42
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0002
Further Details:      
 
Domain Number 2 Region: 9-97
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000401
Family MarR-like transcriptional regulators 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003374   Gene: ENSTTRG00000003599   Transcript: ENSTTRT00000003599
Sequence length 507
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_112:117163:126403:-1 gene:ENSTTRG00000003599 transcript:ENSTTRT00000003599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGPVAEVLLQRLEAADGGLDSAELAAELGVEHQTVVGAVKSLQALGEIIEAELRSTKR
WELTAEGEEIAREGSHEARVFRSVPPEGLPQSELMRLPSGKVGFSTMSNKWIRVYKSAAD
GPRVFRVVDSVEDEVQRRLQLVQGGQAEKLGEKERSELRKRKLLTEVNLKTYWVSKGSAF
STSISKQETELSPEMISSGSWRDRPFKPYNFSAHGVLPDSGHLHPLLKVRTQFRQIFLEM
GFTEMPTDNYIESSFWNFDALFQPQQHPARDQHDTFFLRDPAQAQQLPMDYVHRVKRTHS
QGGYGSQGYKYNWKLDEARKNLLRTHTTSASARALYRLAQKKPFTAAKYFSIDRVFRNET
LDATHLAEFHQIEGVVADHGLTLGHLMGVLREFFTKLXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPTMIKYGINNIRELVGHK
VNLQMVYDSPLCRLDAERGPPSTQEAA
Download sequence
Identical sequences ENSTTRP00000003374 ENSTTRP00000003374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]