SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003409 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003409
Domain Number 1 Region: 10-244
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 4.27e-73
Family Proteasome subunits 0.000000000574
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003409   Gene: ENSTTRG00000003634   Transcript: ENSTTRT00000003634
Sequence length 269
Comment pep:novel genescaffold:turTru1:GeneScaffold_1203:117182:164656:-1 gene:ENSTTRG00000003634 transcript:ENSTTRT00000003634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQLRKVKFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQS
ELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGS
KTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLER
HMSEFMECSLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLE
GLEERPQRKTQPTQPADEPAEKADEPMEH
Download sequence
Identical sequences ENSTTRP00000003409 ENSTTRP00000003409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]