SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003462 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003462
Domain Number 1 Region: 241-343
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.94e-33
Family Spermadhesin, CUB domain 0.00069
Further Details:      
 
Domain Number 2 Region: 690-794
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-32
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 3 Region: 2235-2354
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-31
Family Spermadhesin, CUB domain 0.00097
Further Details:      
 
Domain Number 4 Region: 2069-2177
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.07e-31
Family Spermadhesin, CUB domain 0.00055
Further Details:      
 
Domain Number 5 Region: 1368-1484
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-28
Family Spermadhesin, CUB domain 0.00071
Further Details:      
 
Domain Number 6 Region: 2423-2527
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-26
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 7 Region: 1032-1141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.07e-25
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 8 Region: 2775-2843
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.86e-19
Family Complement control module/SCR domain 0.00083
Further Details:      
 
Domain Number 9 Region: 1897-1970
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.09e-18
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 10 Region: 2832-2900
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.32e-18
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 11 Region: 3071-3141
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.36e-17
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 12 Region: 3014-3082
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.59e-17
Family Complement control module/SCR domain 0.00097
Further Details:      
 
Domain Number 13 Region: 3130-3192
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.42e-17
Family Complement control module/SCR domain 0.0008
Further Details:      
 
Domain Number 14 Region: 2716-2785
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.06e-17
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 15 Region: 3190-3259
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.36e-17
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 16 Region: 2885-2950
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.13e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 17 Region: 548-623
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-16
Family Spermadhesin, CUB domain 0.0056
Further Details:      
 
Domain Number 18 Region: 1592-1661
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000107
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 19 Region: 485-556
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000153
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 20 Region: 2182-2251
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000189
Family Complement control module/SCR domain 0.00094
Further Details:      
 
Domain Number 21 Region: 3310-3378
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000236
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 22 Region: 3249-3305
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000025
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 23 Region: 903-968
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000275
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 24 Region: 974-1034
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000418
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 25 Region: 1199-1315
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000072
Family Spermadhesin, CUB domain 0.0047
Further Details:      
 
Domain Number 26 Region: 2010-2071
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000729
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 27 Region: 628-687
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000138
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 28 Region: 1836-1901
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000208
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 29 Region: 1488-1547
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000324
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 30 Region: 3369-3427
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000114
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 31 Region: 1314-1376
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000128
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 32 Region: 177-238
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000148
Family Complement control module/SCR domain 0.00075
Further Details:      
 
Domain Number 33 Region: 1662-1724
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000405
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 34 Region: 2653-2727
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000528
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 35 Region: 799-862
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000702
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 36 Region: 1147-1204
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000836
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 37 Region: 2353-2416
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000688
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 38 Region: 2527-2588
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000806
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 39 Region: 2968-3008
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000133
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 40 Region: 1720-1757
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000275
Family Spermadhesin, CUB domain 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000003462
Domain Number - Region: 134-178
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00183
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003462   Gene: ENSTTRG00000003680   Transcript: ENSTTRT00000003689
Sequence length 3666
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2398:112393:1183214:-1 gene:ENSTTRG00000003680 transcript:ENSTTRT00000003689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGIRKGESRAKESKPREPDTRKCAKCGRLDFILMKKMGTQSGFTFWNLVFLLTVSCVKX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXLTGFHLPPPVTSTKSVFSLRLTSDFAVSAHGFKVYYEELQSSSCGN
PGIPPKGVLYGTRFDVGDKIRYSCVTGYILDGHPQLTCIASSVNTASWDFPVPICRAEDA
CGGTMRGSSGVISSPSFPNEYHNNADCTWTIVAEPGDTISLIFTDFQMEEKYDYLEIEGS
EPPTIWLSGMNIPPPIISNKNWLRLHFVTDSNHRYRGFSAPYQGSSPLTHTTSTGELEEH
NRTTTGAIAVASTSADVTVSSVTAVTIHRLSEEQRVQVKNIRNSGLDPNTSKDELSPHQA
DIQSTRRRPRNAEQIERTKELAVVTHRVKKAIDFKSRGFKLFPGKDNSNKFSILNEGGIK
TASNLCPDPGEPENGKRVGSDFSLGSTVQFSCDEDYVLQGAKSITCQRIAEVFAAWSDHR
PVCKVKTCGSNLQGPSGTFTSPNFPFQYDSNAQCVWVITAVNTNKLTGSFVPDLIVSMSS
QMWLHLQTDESVGSIGFKVNYKEIEKESCGDPGTPLYGIREGDGFSNRDVLRFECQFGFE
LIGEKSIVCQENNQWSANIPICIFPCLSNFTAPMGTVLSPDYPEGYGNNLNCIWTIISEP
GSRIHLSFNDFDLESQFDFLAVKDGDSPDSPILGTFTGTEVPSHLTSNSHILRLEFQADH
SMSGRGFNITYNTFGHNECPDPGIPINARRFGDNFQLGSSISVICEEGFIKTQGTETITC
ILMDGKVMWSGPIPKCGAPCGGHFSAPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXFQTELNYDVLEVHDGPNLLSPLLGSYNGTQVPQFLFSSSNFIYLLFTTDNSRSNNG
FKIHYESVTVNTYSCLDPGIPVHGHRYGHDFSIGSTVSFSCDPGYRLSHEEPLLCEKNHW
WSHPLPTCDALCGGDVRGPSGTILSPGYPEFYPNSLNCTWTVDVTHGKGVQFNFHTFHLE
DHHDYLLITENGSFTQPLARLTGSELPSTINAGLYGNFRAQLRFISDFSISYEGFNITFS
EYNLEPCEDPGIPQYGNRIGFSFGVGDTLAFSCSSGYRLEGTPEIICLGGGRRVWSAPLP
RCVACGASATSNERILLSPNYPLNYENHCIYSIXXXXXXXXXXXXXXXXXXXXXXXXIYD
GKDKTTHLLGAFTGASMRGLTLSSTSNHLWLEFNSDSEGTDEGFQLVYTSFESHCEDPGI
PQFGYKISDQGHFAGSTIIYGCNPGYTLHGSSLLKCMTGERRAWDYPLPSCIAECGGRFK
GESSGRILSPGYPFPYDNNLRCMWMIEVDPGNIVSLQFLAFDTEASHDILRVWDGPPEND
MLLKEISGSLIPEGIHSTLNIVTIQFDTDFYISKSGFAIQFSSSVATACRDPGVPMNGTR
NGDGREPGDTVVFQCDPGYELQGEERITCIQVENRYFWQPSPPVCIXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFSIEPNYDFLYIYDGPDSNSPLIGSFQ
DSKLPERIESSSNTMHLAFRSDGSVSYTGFHLEYKAKLRECDPGNIMNGTRLGMDYKLGS
TVTYYCDAGYVLQGYSTLTCIIGDDGRPGWNRALPSCHAPCGSRSTGSEGTVLSPNYPKN
YSVGHNCVYSIAVPKEFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXVPRTSSTQCSSVPEPRFGRRIGNEFAVGSLVL
FECNPGYILHGSFAIRCDSVPNSLAQWNDSLPTCIVPCGGILSKRKGTILSPGYPEPYDN
NLNCVWKMTVPEGAGIQVQVVSFATEHNWDSLDFYDGGDNNAPRLGSYSXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXLEYTAIGLDSCPEPQTPSSGNKIGDRYMVGDVVSFQCDQG
YSLQGHSHITCMPGPVRRWNYPIPICLAQCGGSMSDFSGVILSPGFPGNYPSSLDCTWTI
KLPIGFGVHLQFVNFSTETIHDYLEVRSGSAETSTVIGRLSGPQISSSLFSTTHETSLYF
HSDYSQNKQGFHIVYQAYQLQSCPDPRPFRNGFVIGNDFTVGQTISFECFPGYTLIGNSA
LTCLHGVSRNWNHPLPRCEALCGGNITAMNGTIYSPGYPDEYPNFQDCFWLVKVPPGNGI
YINFTVLQTEPIYDFITVWDGPDQNSPQIGQFSGNTALESVYSTSNQILIKFHSDFTTSG
FFVLSYHAYQLRVCQPPPPVPNAEILTEDDEFEIGDIIRYQCLPGFTLVGNAILTCRLGE
RLQMDGAPPVCQVLCPANELRLDSTGVILSPGYPDSYPNLQMCTWSISVEKGYNISMFVE
FFQTEKEFDVLQVYDGPNIQSPVLVSLSGDYSSAFNITSNGHEVFLQWSADHGNNKKGFR
IRYIAFYCSTPESPPHGYIISQTGGQLNSVVRWACDRGFRLVGKSSAVCRKSSYGYHTWD
APVPACQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXVTCPSINSFTLEHGRWRIVNGSHYEYKTKVVFSCDPGYHGLGPASIECLP
NGTWSWRNERPYCQIISCGELPTPPNGNKIGTQTSYGSTAIFTCDSGFMLVGSAVRECFS
SGLWSGSETRCLAGHCGIPELIVNGQVVGENYGYRDTVVYQCNPGFRLIGSSVRICQQDH
NWSGQLPSCVPVSCGHPGSPIYGRTSGNGFNFNDVVTFSCNIGYLMQGPTKAQCQANRQW
SHPPPMCKVVNCSDPGIPANSKRESKIEHGNFTYGTVVFYDCNPGYFLFGSSVLICQPNG
QWDKPLPECIXXXXXXXXXXXXXXXXXXKYTFGSTVRYSCTGKHTFSVQSSRTCQLNGHW
SGSQPHCSGDATGTCGDPGTPGHGSRQESNFRTKSSVRFACDIGYILHGSEERTCLPNGS
WTGRQPECKAVQCGNPGTTANGKVFRIDGTTFSSSVIYSCVEGYILSGPSVRQCTANGTW
SGTLPNCTIISCGDPGIPASGLRYGDDYVVGQNVSYMCQPGYTMELNGSRIRTCTTNGTW
SGVMPACRAVTCPTPPQISNGRLEGTNFDWGFSISYICSPGYELSFPAVLTCVGNGTWSG
EVPQCLPKFCGDPGIPAQGKREGKSFIYQSEVSFSCNSPFILVGSSTRICQADGTWSGSS
PHCIEPTRTSCENPGVPRHGSQNSTFGFQVGSVVQFHCKKGHLLQGSTTRTCLPDLTWSG
IQPECIPHSCKQPETPAHANVVGMDLPSHGYTLIYTCQPGFFLAGGTEHRVCRSDNTWSG
KVPVCEAGSKILVKDPRPALGTPSPKLSVPDDVFAQNYIWKGSYNFKGRKQPMTLTVTSF
NASTGRVNATLSNSNMELLLSGVYKSQEARLILHIYLIKVPTQASVKKMKEENWAMDGFV
SAEPDGATYVFQGFIQGKDYGQFGLQRLGLNMSEGSNSSNQPHGTNSSSVAIAILVPFFA
LIFAGFGFYLYKQRTAPKTQYTGCSVHENNNGQAAFENPMYDTNSKSVEGKAVRFDPNLN
TVCTMV
Download sequence
Identical sequences ENSTTRP00000003462 ENSTTRP00000003462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]