SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003514 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003514
Domain Number 1 Region: 564-612
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000575
Family TSP-1 type 1 repeat 0.00068
Further Details:      
 
Domain Number 2 Region: 644-707
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000256
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 3 Region: 24-78
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000034
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 4 Region: 139-173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 699-755
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000364
Family Complement control module/SCR domain 0.0034
Further Details:      
 
Domain Number 6 Region: 80-128
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000484
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003514   Gene: ENSTTRG00000003737   Transcript: ENSTTRT00000003741
Sequence length 932
Comment pep:known_by_projection scaffold:turTru1:scaffold_112171:5918:93419:1 gene:ENSTTRG00000003737 transcript:ENSTTRT00000003741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARHSILYFILLSALIDKGQACFCDHYPWTQWSSCSKTCNSGTQTRQRYIVVNQYYLENF
CDQLCTKQETRECNWQTCPINCLLGDYGPWSDCDPCVEKQFKVRSILRPSQFGGQPCTEP
LMTFQPCIPSKLCKIEEVDCKNKFRCDSGRCIASKLECNGENDCGDNSDERDCGRKKSVC
SRQYNPIPSVQLMGTGFHFLAGEARGEVLDNSFTGGICKTVKSSRASNPYRFPANLENVN
FEVQTEEDDLETDFYEDLISLDDNKDQQSLAIGQEKSSFHVPIFYSSKRKRSSIHNSAFK
QAIQASYKKDSSFIRIHKVIKVLNFTMKTKDLQLSDVFLKALNHLPLEYNSALYSRIFDD
FGTHYFTSGSLGGVYDLLYQFSKEELKNSGLTKAEAQNCIWVETKKRFLFFTKTKVEDRC
TTNKLSEKYGGSFIQGSEKSISLVQGGRSEYAAALAWEKGSSGPEEKTFSEWLESVKENP
TVIDFKLAPITDLVRNIPCAVTRRNNLMRAYRDYAAKFDPCQCAQCPNNGHPTLSGTECL
CVCQSGTYGENCERRSPDYKSNAVDGNWGCWSSWSTCDATYKRSRTRECNNPAPQQGGKS
CEGKRRQVEHCTFSIMQNDGQPCISDDEEVKEIDLPELESDSGCPQPVPPENAFIRNERK
LYSVGEEVEIICLTGFKPVGYQYFSCLPDRTWRRGDVECQRTECLKPVVQEVLTLSPFQT
LYKIGESIELTCPRGFVVAGPSRYTCSGDSWTPPISSSLTCEKDTLELLKGNCQPGQKQL
GSECICMSPEDCGLYSEDICVLDTRSSHHFTSTACKFLAENCLNNQQLHFLHIGSCQDGP
QLEWGLERTKLSSSSTKKESXXXXXXXXXXXXXXATSKCVCLLPSQCFKSGNQLFCVKMG
SSMSQRTVNICEVGAVRCANRKVEILHPGMCT
Download sequence
Identical sequences ENSTTRP00000003514 ENSTTRP00000003514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]