SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003586 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003586
Domain Number 1 Region: 313-439
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.7e-40
Family Regulator of G-protein signaling, RGS 0.0000427
Further Details:      
 
Domain Number 2 Region: 18-121
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.22e-16
Family DEP domain 0.063
Further Details:      
 
Domain Number 3 Region: 247-302
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.0000000000000824
Family Transducin (heterotrimeric G protein), gamma chain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003586   Gene: ENSTTRG00000003792   Transcript: ENSTTRT00000003815
Sequence length 484
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3043:76392:665426:-1 gene:ENSTTRG00000003792 transcript:ENSTTRT00000003815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSXX
XXXXXXXXXXXXXXXXKTLHLGTLMAAHGYFFPISDHVLTLKDDGTFYQFQTPYFWPSNC
WEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKK
RDKIERKILDSERAFWDVHRPVPGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSHS
PTHTPTPETKPPTEDELQQQLKYWQIQLDRHRLKMSKVADSLLSYTEQYVEYDPFLVPPD
PSNWLSFWELEASKEPSQQRFGMDEALKDPVGKEQFLKFLESEFSSENLRFWLAVEDLKK
RPIREVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNVKEPGRYTFEDAQEHIYKLMK
SDSYPRFIRSSAYQELLQAKKKSEYSMDRRTSFENFAQNVGRNIPIFPCHKNCTPTLRAS
TNLL
Download sequence
Identical sequences ENSTTRP00000003586 ENSTTRP00000003586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]