SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003766 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003766
Domain Number 1 Region: 26-366
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.18e-61
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000134
Further Details:      
 
Domain Number 2 Region: 372-488
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 5.15e-44
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000183
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003766   Gene: ENSTTRG00000003989   Transcript: ENSTTRT00000003999
Sequence length 496
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_391:13247:42090:1 gene:ENSTTRG00000003989 transcript:ENSTTRT00000003999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGHFNRISHGLQGVSAVPLRTYADQPIDADVPVIGSGPGGYVAAIKAAQLGFKAVCVEKN
ETLGGTCLNVGCIPSKALLNNSHYYHMAHGKDFASRGIEMSEVRLNLEKMMEQKSNAVKA
LTGGIAHLFKQNKVAHVNGYGKITGKNQVTATKADGSTQVIDTKNILIATGSEVTPFPGI
TIDEDTVVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGIGI
DMEISKNFQRILQKQGFKFKLNTKVTGATRKPDGKIDVSIEAASGGKAEVITCDVLLVCI
GRRPFTKNLGLEELGIELDPRGRIPVNTRFQTKIPNIYAIGDVVAGPMLAHKAEDEGIIC
VEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGLEYKVGKFPFAANSRAKTNA
DTDGMVKILGQKSTDRVLGAHILGPGAGEMINEAALALEYGASCEDIARVCHAHPTLSEA
FREANLAASFGKSINF
Download sequence
Identical sequences ENSTTRP00000003766 ENSTTRP00000003766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]