SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003780 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003780
Domain Number 1 Region: 1-204,301-335
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000105
Family FAD-linked reductases, N-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003780   Gene: ENSTTRG00000004023   Transcript: ENSTTRT00000004013
Sequence length 342
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3118:48821:279375:-1 gene:ENSTTRG00000004023 transcript:ENSTTRT00000004013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARVLIVGAGLTGSLCAALLRKAATRPLHLAVWDKAGDSGGRMTTASSPHNPQSTVDLGA
QYITCTPHYAKKHQSFYDELLAPGVLKPLTSPIEGMVIKEGDCNFVAPDGVSSIINHYLK
DSXXXXXXXXXXTQINLRNDKWEVLRETGSPELFDIAVLTMPAPQILQLQGDIVNLISEC
QRQQLESVSYSSRYALGLFYEAGTKIDVPWAGQYITSNPCIRFISIDNKKRNIESSEIGP
SLVIHTTVSFGVTYLEHSTEDVQELIFQQLENILPGLPQPVATKCQKWRHSQVTSAAANS
PGQMTLHLKPFLVCGGDGFTQSSFDGCITSALCVLEALKNHI
Download sequence
Identical sequences ENSTTRP00000003780 ENSTTRP00000003780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]