SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003782 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003782
Domain Number 1 Region: 4-162
Classification Level Classification E-value
Superfamily E set domains 3.92e-55
Family RhoGDI-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003782   Gene: ENSTTRG00000004026   Transcript: ENSTTRT00000004015
Sequence length 166
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_34:59376:60766:-1 gene:ENSTTRG00000004026 transcript:ENSTTRT00000004015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPASERLPINPRDLDPNAGRFVRYQFT
PAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIY
DFPPLSEELINEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSGTP
Download sequence
Identical sequences A0A2F0AY17
ENSTTRP00000003782 ENSTTRP00000003782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]