SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003829 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003829
Domain Number 1 Region: 51-168
Classification Level Classification E-value
Superfamily C-type lectin-like 4.02e-30
Family C-type lectin domain 0.00000619
Further Details:      
 
Domain Number 2 Region: 264-330
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000032
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 3 Region: 209-274
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000005
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 4 Region: 171-205
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000994
Family EGF-type module 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003829   Gene: ENSTTRG00000004067   Transcript: ENSTTRT00000004065
Sequence length 384
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_971:324041:346688:-1 gene:ENSTTRG00000004067 transcript:ENSTTRT00000004065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CYRRTTEGRSKAMIFPWKCQSAQRGLWNVFELWVWTVLCCDFFAHHGTDCWTYHYSKRPM
TWEKARMFCRKNYTDLVAIQNKGEIEYLNKTLPFSPKYYWIGIRKVEGAWTWVGTNKSLT
EEAENWGHGEPNNKKSKEDCVEIYIKRAKDAGKWNDDACHKAKTALCYTASCQPLSCSGH
GQCMEIINNYTCNCDLGHYGPQCQFVTQCEPLEAPELGTMACIHPLGNFSFTSQCAFNCF
EGTDIVGIEETTCGPFGNWSSPKPTCRVIQCEPLTAPDFGTMDCSHPLVDFGFTSTCTFS
CSEGAELIGAKKTICGSSGNWSSPSPICQKVDRNFSKIKEGDYNPLFIPVAVMVTTFSGL
AFIIWLARRLKKGKKSRRSMDEPY
Download sequence
Identical sequences ENSTTRP00000003829 ENSTTRP00000003829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]