SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003835 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003835
Domain Number 1 Region: 23-166
Classification Level Classification E-value
Superfamily C-type lectin-like 1.07e-33
Family C-type lectin domain 0.00000165
Further Details:      
 
Domain Number 2 Region: 242-314
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.92e-16
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 3 Region: 298-365
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000057
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 4 Region: 179-252
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000208
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 5 Region: 398-461
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000236
Family Complement control module/SCR domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003835   Gene: ENSTTRG00000004071   Transcript: ENSTTRT00000004071
Sequence length 583
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_971:357908:366093:-1 gene:ENSTTRG00000004071 transcript:ENSTTRT00000004071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIASQFLSALTFVLLLFKESGAWSYNASTEPMTFDEASAYCQQRYTHLVAIQNQEEIKHL
NSTFSYSPSYYWIGIRKVNDTWTWIGTQKPLTEEATNWAPGEPNNKQSNEDCVEIYIKRE
KDSGKWNDERCSKKKLALCYTAACTPTSCSGHGDCRETVNSHTCQCHPGFTGLKCEQVVT
CQAQEAPEHGSLVCNDPLGKFSYNSSCYVSCGEGYLPSSPEATQCTSSGEWSVPLPACNM
AKCDALRSPVNGVVKCFQSHGSFLWNTTCEFECNEGYKLTGPQHLQCISSGIWDNKKPTC
KAVTCDAISHPQNGAVSCSHSPAGEFTYKSSCHFTCAEGFVLQGPAQVECTTQGQWTQQV
PVCEAFPKALSSPERGYVSCLPSTSESFQSGSMGEFSCEPVKCDAIPQPRSGSVNCTHSP
TGEFTKSSCAILCEEGFELRGSPQLECTSQGQWTQEVPSCQXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSKSQTPLAVGLSAAGVSL
MTLASFLLWLLKRLQKKAKKFVPASSCQSLQSDGSYQTISELT
Download sequence
Identical sequences ENSTTRP00000003835 ENSTTRP00000003835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]