SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003873 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003873
Domain Number 1 Region: 596-703
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-20
Family Spermadhesin, CUB domain 0.0026
Further Details:      
 
Domain Number 2 Region: 422-526
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-19
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 3 Region: 709-772
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000769
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 4 Region: 768-830
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000528
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 5 Region: 835-895
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000208
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 6 Region: 355-417
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000306
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 7 Region: 531-595
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000135
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 8 Region: 240-356
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000055
Family Spermadhesin, CUB domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003873   Gene: ENSTTRG00000004111   Transcript: ENSTTRT00000004111
Sequence length 993
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_34:389575:433299:-1 gene:ENSTTRG00000004111 transcript:ENSTTRT00000004111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSADLLLLPSLLALLAHGLSSEAPTVGEEQAPGMEEMDGELTVNPTPEQPERGIHFVTT
APTLKLLNHHPLLEEFLQEGLEEGETELRPAQPFRPDPPTPYTPSPLPLLAKQDSRPVFT
SPTPAIVAAPTQPQSREGPWSLESEPSALHITAPLPPGPSMAMPTPGPAEAHTTPPSXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XPCSWNFSGPEGSLDSPTAPSSPLDVGLDCFYYISVYPGYGVEIKVQNISLREGETITVE
GLGGPDPLPLANQSFLLRGHVIRSPTHQAALRFQSLPPPAGPGTFHFYYQAYLLSCRFPR
RPAYGAVTVTSLHPGGSARFHCATGYQLKGARLLTCLNATQPLWDSQEPVCIGEYPGVIR
NATTGRIVSPGFPGNYSINLTCHWLLEAPEGQRLHLHFEKVSLAEDDDRLIIRNGDNVEA
PPVYDSYEVEYLPIEGLLSSGRHFFVELSTDSSGAAAGMALRYEAFQQGHCYEPFVKYGN
FSSSAPSYPVGTTVEFSCDPGYTLEQGSIIIECVDPHDPQWNETEPACRAVCSGEITDSA
GVVLSPNWPEPYGRGQDCIWGVHVEEDKRIMLDVRVLRIGPGDVLTFYDGDDLTARVLGQ
YSGPRGHFKLFTSMADVTIQFQSDPGASVLGYQQGFVIHFFEVPRNDTCPELPEIPNGWK
SPSQPELVHGTVVTYQCYPGYQVVGSSVLMCQWDLTWSEDLPSCQRVTSCHDPGDVEHSR
RLISSPKFPVGATVQYICDQGFVLTGSAILTCHDRQASSPKWSDRPPKCLLEHLKPCHGL
SAPENGARSPEKQLHPAGATIHFSCAPGYVLKGQASIKCVPGHPSHWSDPPPICRAASLD
GFYSGRSLDVAKAPAASSTLDAAHIAAAIFLPLVAMALLVGGVYLYFSRLQGKSPLQLPR
TRPRPYDRITVESAFDNPTYETGSLSFAGDERI
Download sequence
Identical sequences ENSTTRP00000003873 ENSTTRP00000003873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]