SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003874 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003874
Domain Number 1 Region: 8-218,302-313,349-383
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.61e-42
Family FAD-linked reductases, N-terminal domain 0.00017
Further Details:      
 
Domain Number 2 Region: 221-314
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.26e-18
Family D-aminoacid oxidase-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003874   Gene: ENSTTRG00000004112   Transcript: ENSTTRT00000004112
Sequence length 389
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_34:466581:477738:1 gene:ENSTTRG00000004112 transcript:ENSTTRT00000004112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQKDLYDAIVIGAGIQGCFTAYHLAKHRKRVLLLEQFFLPHSGSSHGQSRIIRRAYPE
DFYTQMMAECYQIWAQLEHEAGTQLYRQTGLLLLGMKENAELKIIQATLSRQGVEHQCLP
SEELKQRFPNIRLARGEVGLLEKSGGVLYADKALRALQDAIRQLGGIVHDGEKVMEIKPG
LLVMVKTTSRSYQAKSLIITAGPWTNRLLRPLGIELPLQTLRINVCYWREKVPGSYGVSQ
AFPCFLGFGLAPYHIYGLPSGEYPGLMKVCYHHGNNADPEERDCPAAFSDIQDVHILSCF
VRDHLPNLEPEPAVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHGFKLSPVVGKIL
YELSMKLMPSYDLTPFRISRFPRLGKAHI
Download sequence
Identical sequences ENSTTRP00000003874 ENSTTRP00000003874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]