SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003918 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003918
Domain Number 1 Region: 536-994
Classification Level Classification E-value
Superfamily Ras GEF 1.12e-134
Family Ras GEF 0.000000000000407
Further Details:      
 
Domain Number 2 Region: 1-148
Classification Level Classification E-value
Superfamily Histone-fold 1.81e-45
Family TBP-associated factors, TAFs 0.00000127
Further Details:      
 
Domain Number 3 Region: 178-364
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.68e-40
Family DBL homology domain (DH-domain) 0.000000232
Further Details:      
 
Domain Number 4 Region: 387-543
Classification Level Classification E-value
Superfamily PH domain-like 3.41e-37
Family Pleckstrin-homology domain (PH domain) 0.00000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003918   Gene: ENSTTRG00000004164   Transcript: ENSTTRT00000004163
Sequence length 1303
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3562:141714:214855:-1 gene:ENSTTRG00000004164 transcript:ENSTTRT00000004163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQEQVHPNLSANEESLYYIEELIFQLLNKLCMAQPRTVQDVEERVQKTFPHPIDKWAIAD
AQSAIEKRKRRNPLLLPVDKIHPSLKEVLGYKVDYHVSLYIVAVLEYISADILKLAGNYV
FNIRHYEISQQDIKVSMCADKVLMDMFDQDDIGLVSLCEDEPSSSGELNYYDLVRTEIAE
ERQYLRELNMIIKVFREAFLSDRDLFKPSDIEKIFSNILDIHELTVKLLGLIEDTVEMTD
ESSPHPLAGSCFEDLAEEQAFDPYETLSQDILSPKFNEHFSKLMARPAVALHFQSIADGF
KEAVRYVLPRLMLVPVYHCWHYFELLKQLKACSEEHENRECLNQAITALMNLQGSMDRIY
KQYSPRRRPGDPVCPFYNRQLRSKHLAIKKMNEIQKNIDGWEGKDIGQCCNEFIMEGPLT
RIGAKHERHIFLFDGLMISCKPNHSQSRLPGYSSAEYRLKEKFVMRKIQICDKEDTCECK
HAFELVSKDENSIIFAAKSAEEKNNWMAALISLHYRSTLDRMLDSVLLKEENEQPLRLPS
PEVYRFVVKDSEENIVFEDNLQSRSGIPIIKGGTVVKLIERLTYHMYADPNFVRTFLTTY
RSFCKPQELLSLLIERFEIPEPEPTEADKLAVEKGEQPISADLKRFRKEYVQPVQLRILN
VFRHWVEHHFYDFERDLELLERLESFISSVRGKAMKKWVESIAKIIKRKKQAQANGISHN
ITFESPPPPIEWHISRPGQFETFDLMTLHPIEIARQLTLLESDLYRKVQPSELVGSVWTK
EDKEINSPNLLKMIRHTTNLTLWFEKCIVEAENFEERVAVLSRIIEILQVFQDLNNFNGV
LEIVSAVNSVSVYRLDHTFEALQERKRKILDEAVELSQDHFKKYLLKLKSINPPCVPFFG
IYLTNILKTEEGNNDFLKKKGKDLINFSKRRKVAEITGEIQQYQNQPYCLRIEPEMRRFF
ENLNPMGNASEKEFTDYLFNKSLEIEPRNCKQPPRFXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXSNSIFAPVLLPHSKSFFSSCGSLHKLSEEPLIPPPLPPRKKFDHDASNSKGTMKSD
DDPPAIPPRQPPPPKVKPRVPAPSGAFDGPLHSPPPPPPRDPLPDTPPPVPLRPPEHFIN
CPFTLQPPPLGHLHRDPDWFRDVSTCPNSPNTPPSTPSPRVPRRCYVLSSSQNNLAHPQA
PPVPPRQNSSPHLPKLPPKTYKRELSHPPLYRLPLLENAETPQ
Download sequence
Identical sequences ENSTTRP00000003918 ENSTTRP00000003918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]