SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004002 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004002
Domain Number 1 Region: 41-259
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.79e-60
Family DBL homology domain (DH-domain) 0.000017
Further Details:      
 
Domain Number 2 Region: 245-391
Classification Level Classification E-value
Superfamily PH domain-like 2.28e-34
Family Pleckstrin-homology domain (PH domain) 0.00061
Further Details:      
 
Domain Number 3 Region: 505-636
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.31e-30
Family DEP domain 0.0012
Further Details:      
 
Domain Number 4 Region: 408-522
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.92e-27
Family DEP domain 0.0037
Further Details:      
 
Domain Number 5 Region: 621-705
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000306
Family PDZ domain 0.024
Further Details:      
 
Domain Number 6 Region: 708-771
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000439
Family PDZ domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004002   Gene: ENSTTRG00000004220   Transcript: ENSTTRT00000004252
Sequence length 1653
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1130:72644:269134:-1 gene:ENSTTRG00000004220 transcript:ENSTTRT00000004252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVPGGSDPSGDGAGDGAHLDPRAPGAAAPISGQCAAARESERQLRLRLCVLNEILGTER
DYVGTLRFLQSAFLHRIRQNTADSVEKGLTEENVKILFSNIEDILEVHKDFLAALEFCLH
PEPQSQHELGNVFLKFKDKFCVYEEYCSNHEKALRLLVELNKIPTVRAFLLSCMLLGGRK
TTDIPLEGYLLSPIQRICKYPLLLKELAKRTPGKHPDHPAVQSALQAMKTVCSNINETKR
QMEKLEALEQLQSHIEGWEGSNLTDICTQLLLQGTLLKISAGNIQERAFFLFDNLLVYCK
RKSRVTGSKKSTKRTKSINGSLYIFRGRINTEVMEVENVEDGTADYHSNGYTVTNGWKIH
NTAKNKWFVCMAKTAEEKQKWLDAIIREREQRESLKLGMERDAYVMIAEKGEKLYHMMMN
KKVNLIKDRRRKLSTVPKCFLGNEFVAWLLEIGEISKTEEGVNLGQALLENGIIHHVSDK
HQFKNEQVMYRFRYDDGTYKARSELEDIMSKGVRLYCRLHSLYIPVIKDRDYHLKTYKSV
LPGSKLVDWLLAQGDCQTREEAVALGVGLCNNGFMHHVLEKSEFKDESQYFRFHADEEME
GTSSKNKQLRSDFKLVENILAKRLLILPQEDDYGFDIEEKNKAVVVKSVQRGSLAEMAGL
QVGRKIYSVNEDLVFLRPFAEVESIVSQSFCSRRPLRLLVATKAKEIIKVPDRPEALCFQ
IRGAAPPYVYAVGRGSEAVAAGLCAGQCILKVNGNNVMNDGAPEVLEHFQAFRSHREEAL
GLYQWVYHTHEDAQEAREAPSEDPSGEGAREEDQSNSAFPLLSLGPQLSLHEDSPVVSLT
VDNVHLEHGVVYEYVSTAGIKCHVLEKIVEPRGCFGLTAKILEAFATDDSVFVQNCGRLM
ALSNNIRTMSHYEFRNICDTKLESIGQRIALYQEFAAQLKSRVSPPFKQAPLEPHPLCGL
DFCPTNCHVNLMEVSYPKTTPSVGRSFSIRFGRKPSLIGLDPEQGHLNPMSYTQHCITTM
AAPSWKCLPAADGDPQSQGPNDSSFGSANGTLGQEHRGLSFLLKQEDREIQDAYLQLFTR
LDVALKEMKQYVTQINRLLSTITEPTSGGSCDPPLAEASSPXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXECNSNRDSVLSYTSVRSNSSYLGSDEMGSGDELP
CDMRIPSDKQDKLHGCLEHLFNQVDSIHALLKGPVMSRAFEETRHFPMDHSLQEFKQKEE
CTIRGRSLIQISIQEDPWNLPNSIKTLVDNIQRYVEDGKNQLLLALLKCTDTELQLRRDS
IFCQALVAAVCTFSEQLLAALSYRYNNNGEYEESSRDASRKWLEQVAATGVLLHCQSLLS
PAAKEERTMLEDIWVTLSELDNVTFSFKQLDENYVANTNVFYHIEGSRQALKVIFYLDSY
HFSKLPSRLESGASLRLHTVLFTKALENMEVPPPPGSQTVEDLQQEINAQSLEKVQQYYR
KLRAFYLERSNLPTDASTTAVKIDQLIRPINALDELCRLMKSFVYHKPGATGSLGAGLIP
ISSELCYRLGACQMTMCGTGMQRSTLSLSLEQAAILARSHGLLPKCIMQATDIMRKQGPR
VEILAKNLRVKDQMPQGAPRLYRLCQPPVDGDL
Download sequence
Identical sequences ENSTTRP00000004002 ENSTTRP00000004002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]