SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004004 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004004
Domain Number 1 Region: 59-247
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.24e-63
Family Proteasome subunits 0.000000209
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004004   Gene: ENSTTRG00000004259   Transcript: ENSTTRT00000004254
Sequence length 247
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3463:49749:54032:-1 gene:ENSTTRG00000004259 transcript:ENSTTRT00000004254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLDVCGAPRGQREDWAFPHAGSRQRSDPGHYSFSLRSPELALPLGMQXXXXXXSLGGN
GERNIQIEMAHGTTTLAFKFQHGLIVAVDSRASAGNYIGTLTVNKVIEMNPYLLGTMSGC
AADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKG
PGLYYVDADGTRLSGNMFSTGSGCSHAYGVMDTGYRPDLSIEEACDLGRRAIVHATHRDS
YSGGVVN
Download sequence
Identical sequences ENSTTRP00000004004 ENSTTRP00000004004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]