SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004019 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004019
Domain Number 1 Region: 15-218
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 7.33e-55
Family Proteasome subunits 0.000000453
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004019   Gene: ENSTTRG00000004272   Transcript: ENSTTRT00000004271
Sequence length 219
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3463:63852:70391:1 gene:ENSTTRG00000004272 transcript:ENSTTRT00000004271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRAGAPTGDLPRAREVHTGTTIMAVEFDGGVVVGSDSRVSAGEAVVNRVFDKLSPLHQR
IYCALSGSAADAQAIADMAAYQLELHGMEMEELPLVLAAANVVRNITYKYREDLSAHLMV
AGWDRREGGQVYGTMGGMLIRQPFAIGGSGSTYIYGYVDAAYKRGMSPEECRRFTTNAIA
LAMNRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE
Download sequence
Identical sequences XP_004267808.1.21590 XP_004326051.1.83887 ENSTTRP00000004019 ENSTTRP00000004019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]