SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004024 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004024
Domain Number 1 Region: 1265-1379
Classification Level Classification E-value
Superfamily PH domain-like 3.56e-34
Family Pleckstrin-homology domain (PH domain) 0.00099
Further Details:      
 
Domain Number 2 Region: 1069-1247
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.16e-19
Family DBL homology domain (DH-domain) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004024   Gene: ENSTTRG00000004274   Transcript: ENSTTRT00000004276
Sequence length 1520
Comment pep:known_by_projection scaffold:turTru1:scaffold_105657:79371:100132:1 gene:ENSTTRG00000004274 transcript:ENSTTRT00000004276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPEPVEDCVQSTLAALYPPFEATAPTLLGQVFQVVERTYREDALRYTLDFLVPAKHLLA
KVQQEACAQYSGFLFFHEGWPLCLHEQVVVQLAALPWQLLRPGDFYLQVVPSAAQAPRLA
LKCLAPGGGRVQELPVPNEACAYLFTPEWLQGVNKDRPTGRLSTCLLSAPSGIQRLPWAE
LICPRFVHKGGLMVGHRPSTLPPEVPSGPPGLPSPPLPEEALGTRSPGDGHNAPAEGPEG
EYVELLEVTLPVRGSPTDADGSSGLSRTRTVPTRKGAGGKGRHRRHRAWMHQKGLGPRDQ
DGARPPGEGSSTGASPACPPGAEAEALPEAAALEVSEPPAEALGEASEFCPLRPGEVGGG
AGQGAEGPPGTPRRAGKGNRRKKRAAGRGALNRGGDSAPLSPGDKEETSHQEALVSPPPP
SEHELPGCGPVKEEHEGSGKPDPEPREELKPADEGEPRPPEACGPVEERAREREPEGPRL
VRVAGPSNPEGLLSDPLAPSPETVQEVKGDSIPEEATPVSSSDDPGVAWDLMSSGCLVLT
GGVDQSGRALLTITPPSPPEEPPLSEDVLSTALHYLHSLLRPDLQVLGLSVLLDLRKAPA
LPPALIPVLSQLQDSGDPPVIQRLLLLTHDDPPTELHGFQGAELLSESDLKRVAKPEELQ
WDLGGHRDPSPSHWVETHKEVERLCRLCRGVLGSVRRAIEELERAADPEGEEAAGMPEPL
QKVLADPRLTELQRDGGAILMRLRSTHSSKLEGPGPATLYQEVDEAIHQLVRLSNLHVQQ
QEQRQRLHRLQQVLRWLSGPGEEQLVSFAVPGDSLSALQETELRFRAFSAEVQERLAQAR
EALALEEDPASQKLLDIFEQRLEQVESGLHRALRLQRFFQQXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEDYEDE
GPELAPEAEGRPPRTVLIRGLEVTSTEVVDRTCSPREHVLLGRAGGPEGPWGVGTPRMER
KRSISAQQRLVSELIACEQEYVATLSEPVPPAGPELTPELRGTWEAALSARERLRSFHRT
HFLRELQGCATHPLRIGACFLRHGDQFSLYAHYVKHRHKLENGLAALSPPTKGTMEGGPH
LPRALQQPLEQLARYGRLLEELLREAGPEPSSERQALGAAMQLLREQETRGKDLLAVEAV
RGCEIDLKEQGQLLHRDPFTVICGRKKCLRHVFLFEHLLLFSKLKGPEGGSETFVYKQAF
KTADMGLTENIGDSGLCFELWFRRRRAREAYTLQAASPEIKLKWTSSIAQLLWRQAAHNK
ELRVQQMVSMGIGNKPFLDIKALGERTLSALLTGRAARTRASVAVSSFEHAGPSLPGLSP
GACSLPARVEEEAWDLDVKQISLAPETFASSGDVSPGPRNSPSLQRPHPGSSTPILASGG
ILGLSRQSHARALSDPTTPL
Download sequence
Identical sequences ENSTTRP00000004024 ENSTTRP00000004024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]