SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004056 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004056
Domain Number 1 Region: 1261-1370
Classification Level Classification E-value
Superfamily PH domain-like 2.39e-24
Family Pleckstrin-homology domain (PH domain) 0.0034
Further Details:      
 
Domain Number 2 Region: 38-135
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.67e-20
Family FHA domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000004056
Domain Number - Region: 762-893,1262-1282
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00952
Family BAR domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004056   Gene: ENSTTRG00000004310   Transcript: ENSTTRT00000004312
Sequence length 1381
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3414:272599:312218:1 gene:ENSTTRG00000004310 transcript:ENSTTRT00000004312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTINRNQVGPGSKTPAMVQKGPLDLIETGKGLKVQTDKPHLVSLGSGRLSTAITLLPLE
EGRTVIGSAARDISLQGPGLAPEHCYIENLRGTLTLYPCGNACTIDGLLVRQPTRLTQGC
MLCLGQSTFLRFNHPAEAKWMKSMIPAGGRAPGPTYSPGPAESQSLVNGNHTPQPATQGP
SACGSHSSLVSSIEKDLQEIMDSLVLEEPGAAGKKPAATSPLSPMANGGRYLLSPPTSPG
AMSVGSSYENTSPAFSPLSSPASSGSCASHSPSGQEPAPSMPPLVPARSSSYHLALQPSQ
SRPSGARPSESPRLGRKGGHERPPSPGLRGLRTDSPAATVLAVACRATESPRAGGQLPLV
AIGLSEYQASGARGQPTSIPGSPKFQPPVPAPRNKIGTLQDRPPSPFRELPGTERVLTTS
PSRQLVGRTFSDGSATRTLQPPESPRLGRRGLDSMRELPPLSPSLSRRALSPMPARTTPD
PKLTREVAESPRPRRWAAHGASPEDFSVTLGARGRRTRSPSPTLGESLAPRKGSFSGRLS
PAYSLGSLTGASPHQSPRAQRKLSSGDLRVPVTRERKNSITEISDNEDDLLEYHRRQRQE
RLREQEMERLERQRLETILNLCAEYSRADGGPEAGELPSIGEAAAALALAGRRPSRGLVG
GTGASARSNEEPGGATQRLWETVERSDEENLKEECSSTESTQQEHEDAPSAKLQGEVLAL
EEERAQVLGRVGQLKVRVKELEQQLQESAREAEMERALLQGEREAERALLQKEQKALDQL
QEKLVTLETGIQKERDKEAEALETETKLFEDLEFQQLERESRVEEERELAGQGLLRSKAE
LLRSIAKRKERLAVLDSQAGQIRSQAVQESERLARDKNASLQLLQKEKEKLAMLERRYHS
LTGGRAFPKTTSTLKEMEKLLLPAVDLEQWYQELMAGLGTGPAAASPRSSPPPLPAKASR
QLQVYRSKMDGEATSPLPRTRSGPLPSSSGSSSSSSQLSVATLGRSPSPKSTLLAQNGTS
SLPRNLAATLQDIETKRQLALQQKGQQVIEEQRRRLAELKQKAAAEAQCQWDALHGAAPF
PAGPSGFPQLLHHSILHHLPVSRERGEEGEHAYDTLSLESSDSMETSISTGGNSACSPDT
MSSASGLDVGKTEEMEKMLKEAHAEKSRLMESREREMELRRQALEEERRRREQVERRLQG
ESTRRHQLVEKEVKMREKQFSQARPLTRYLPIRKEDFDLKTHIESSGHGVDTCLHVVLSS
KVCRGYLVKMGGKIKSWKKRWFVFDRLKRTLSYYVDKHETKLKGVIYFQAIEEVYYDHLR
SAAKKRFLSFTMVSESPNPALTFCVKTHDRLYYMVAPSAEAMRIWMDVIVTGAEGYTQFM
N
Download sequence
Identical sequences ENSTTRP00000004056 ENSTTRP00000004056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]