SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004075 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004075
Domain Number 1 Region: 526-594
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.34e-17
Family Complement control module/SCR domain 0.00033
Further Details:      
 
Domain Number 2 Region: 275-344
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.39e-17
Family Complement control module/SCR domain 0.00047
Further Details:      
 
Domain Number 3 Region: 154-225
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.42e-17
Family Complement control module/SCR domain 0.0006
Further Details:      
 
Domain Number 4 Region: 410-473
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000702
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 5 Region: 215-286
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000229
Family Complement control module/SCR domain 0.00092
Further Details:      
 
Domain Number 6 Region: 350-420
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000681
Family Complement control module/SCR domain 0.00098
Further Details:      
 
Domain Number 7 Region: 910-967
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000121
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 8 Region: 600-658
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000129
Family Complement control module/SCR domain 0.00047
Further Details:      
 
Domain Number 9 Region: 90-148
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000598
Family Complement control module/SCR domain 0.000089
Further Details:      
 
Domain Number 10 Region: 21-83
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000136
Family Complement control module/SCR domain 0.00014
Further Details:      
 
Domain Number 11 Region: 493-537
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000195
Family Complement control module/SCR domain 0.008
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000004075
Domain Number - Region: 743-775
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00118
Family Complement control module/SCR domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004075   Gene: ENSTTRG00000004329   Transcript: ENSTTRT00000004331
Sequence length 1092
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3274:115611:144225:1 gene:ENSTTRG00000004329 transcript:ENSTTRT00000004331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGASGPLWVFLAFAVPGVLGIFCDPPPRIKNGRNSYHPSPIAINAVVRYSCSSAFRLIGE
SILFCITKDNVNGIWDKAAPICEYYNKNSICSEPIVPGGYRNKMSRPPYRHGDSVTFTCN
ANFTMKGNKTVWCQANKTWGPTPLPTCESDISLECPSLPTIANGYHTGESVDSFAPGLSV
TYSCEPGYLLLGEKTIRCLSSGDWSAVAPTCKEAECKPPGPFLNGQLKRPTSLRVGATVN
FFCSEGYRLQGPPSSQCVIVGQRAFWTKFPVCEEILCPPPPPILNGRHTGSSSMNVRYGS
TVTYTCDRGPEQGVNFILTGERTIRCTTDSQKTGTWSGPAPRCELSVSEVRCPPPQILRG
QISSGQKDQYSYNDTVVFACVFGFTMKGSKGIRCNAQGSWEPSVPVCEKDCQAPPKILHG
QKEDRHMIRFDPGTSIKYSCDPGYVLVGEESIHCTSEGVWIPTAPTCKVAECEPIGKQVF
KKPKNQLIRLDVNSSCDEGYRLSESVYQQCQGTIPWFMEIRLCKDITCPPPPVIYNGVHT
GGSSDVLYGTTVTYTCNPGPERGVKFNLIGESTIRCTSNDQETGIWSGPAPVCKLSLPAV
QCSHVHIANGYKISSKEAPYFYNDSVIFKCNNGFTLKGSSQVRCKANNTWDPETPVCEKG
CQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEEA
PCQPLKEGLREVPVGSPVVPVNMCQDGYRLTGHAYRKCQDDRNRVWFQKILLCKXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXFLGCQRPFKIPHGNHTGGDIARFSPGMSILYSCNRGYLLVGEAVLLCTHEGTWN
GPVPYCKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNYYTNTNRKEDVRLETL
EVYSVDPYNLAN
Download sequence
Identical sequences ENSTTRP00000004075 ENSTTRP00000004075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]