SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004088 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004088
Domain Number 1 Region: 1-193
Classification Level Classification E-value
Superfamily Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 6.41e-40
Family Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004088   Gene: ENSTTRG00000004348   Transcript: ENSTTRT00000004344
Sequence length 197
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1229:18282:43520:1 gene:ENSTTRG00000004348 transcript:ENSTTRT00000004344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FGPFGEHTVNASWIAVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLVVH
VGVSGMATTVTLEKCGHNKGYKGLDNCRFCPGSQCCVEDGPESIDSIIDMDAVCKRVTTL
GLDVSVTISQDAGRYLCDFAYYTSLYQSHGRSAFVHVPPLGKPYNADQLGRALQAIIEEM
LDVLEQSEGKLNCCHKH
Download sequence
Identical sequences ENSTTRP00000004088 ENSTTRP00000004088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]