SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004107 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004107
Domain Number 1 Region: 316-448
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 4.8e-27
Family Diacylglycerol kinase-like 0.013
Further Details:      
 
Domain Number 2 Region: 50-171
Classification Level Classification E-value
Superfamily PH domain-like 4.93e-21
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 3 Region: 1143-1208
Classification Level Classification E-value
Superfamily SAM/Pointed domain 7.86e-19
Family SAM (sterile alpha motif) domain 0.0047
Further Details:      
 
Domain Number 4 Region: 217-286
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.79e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000203
Further Details:      
 
Domain Number 5 Region: 154-212
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000867
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0098
Further Details:      
 
Domain Number 6 Region: 794-890
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 0.00000024
Family NAD kinase-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004107   Gene: ENSTTRG00000004354   Transcript: ENSTTRT00000004363
Sequence length 1210
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_295:1432:109400:1 gene:ENSTTRG00000004354 transcript:ENSTTRT00000004363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAGAFKTGPPQPTQLAPPDETSNIIRFLPSAPLNIILGVSTGLHHITVIKEGMLTKQ
NNSFQRSKRRYFKLRGRTLYYAKTAKSIIFDEVLTDASVAESSTKNVNNSFTXXXXXXXX
ILCADNRKEMEDWIAALKTVQSREHFEPTQYSMDHFSGIHNWYACSHARPTYCNVCREAL
SGVTSHGLSCEVCKFKAHKRCAVRATSNCKWTTLASIGKDIIEDEDGIAMPHQWLEGNLP
VSAKCTVCDKTCGSVLRLQDWRCLWCKAMVHTACKESLLTKCPLGLCKVSVIPPTALNSI
DSDGFWKATCPPSCTSPLLVFVNSKSGDNQGVKFLRRFKQLLNPAQVFDLMNGGPHLGLR
LFQKFDTFRILVCGGDGSVGWVLSEIDSLNLHKQCQLGVLPLGTGNDLARVLGWGSACDD
DTQLPQILEKLERASTKMLDRWSVMAYETKLPRPASSSTVTEDLSEGSEVQQILFYEDSV
AAHLSKILTSDQHSVVISSAKVLCETVKDFVARVGKAYEKTTESSEESEVMAKKCSVLKE
KLDSLLKTLDDESQASSSLPTPPPTIAEEAEDGEGAGGSCGSSSTGDRAVGSACPARPQI
FRPREQLMLRANSLKKAIRQIIEHTEKAVDEQNAQTQEHEGFILGLSESEEKKDLKSDDR
ACRRGHGEGHGAAKGRSLRRVSKSPCEKLISKGSLSLGGSASLPSQSGNQDSLPALNTKI
LFPNVRAGMSGSLPGGSVISRLLINADPFNSEPENLXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXSRTKNMMWYGVLGTRELLHRTYKNLEQKVLLECDGRPIPLPSLQGIA
VLNIPSYAGGTNFWGGTKEDDTFAAPSFDDKILEVVAVFGSMQMAVSRVIKLQHHRIAQX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIREAARXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLDPPQKERLTAALVE
MDQQLRKLADTPWLCQPVEPGDEENVMLDLSKRSRSGKFRLVTKFKKEKNNKNREARSSL
GAPVHLWGTEEVAAWLEHLSLCEYKDIFTRHDIRGSELLHLERRDLKDLGVTKVGHMKRI
LCGIKELSRS
Download sequence
Identical sequences ENSTTRP00000004107 ENSTTRP00000004107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]